KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_06115Help
Entry
SAVC_06115        CDS       T01745                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:suv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAVC_06115 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVC_06115 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAVC_06115 (trpA)
Enzymes [BR:suv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAVC_06115 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1319688..1320416
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGNKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFNQLEKHGDQIKCNYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPYELSQRL
KQQFSHYGVKIISLVAMTTDDKRIKDIVSHAEGFIYTVTMNATTGQNGAFHPELKRKIES
IKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKRFKSNTREEIIKYLQSIQQTL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggcaataaagatttgattgaaaatgcaaca
ttgttgagtgaaaatggtgcagatataattgaaattggagtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggtcaacaagcgattaaacaaggcatcacgata
gattatattttcaatcaattagaaaaacatggtgatcaaattaagtgtaactatgtatta
atgacgtattataatattatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gatactggtgtctacggcttaattattcctgatttaccatatgaattatcgcagcgttta
aaacaacaatttagtcactatggcgtcaaaatcatatcgttagttgcgatgactactgat
gacaaacgtataaaagatatcgtatcccatgcggaaggctttatttatactgtgacgatg
aatgcgacaacagggcaaaacggtgcgtttcatccagaattaaaacgaaaaattgagtca
attaaagcgatagccaatgtgccagttgtcgcaggatttggtataagaacaccacaacat
gttgcagatataaaagaggttgcagatggcattgtcattggtagcgaaatcgttaagcga
tttaaatctaacacgcgtgaggaaatcattaaatatttacaatctatccaacaaacattg
aataattaa

DBGET integrated database retrieval system