KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_12265Help
Entry
SAVC_12265        CDS       T01745                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:suv01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:suv00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2657613..2658863)
Genome map
AA seq 416 aa AA seqDB search
MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHE
QIKAAFDTLDEKTKQALQQSYERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYVPG
GKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVLAACYITQVDQVFQVGGAQSI
AALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDETADLDAIV
YDVFAQAEHDELARTYAISEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASN
FDEACHVMNTIAPEHASIQTVNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTN
RTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAHVEALYNHQQSILIRQS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgcacaacaatttttaaatcaattttcattagaagcaccattagatgagtca
ttgtatccaattattcgcgatatttgtcaggaagttaaagttcatggagataaggctttg
aaaatgtataatctaacattcgatcatacgaaaacagatcatttagaaattagtcatgaa
caaattaaagcagcatttgacacattagatgaaaaaacaaaacaagcattacaacaaagt
tatgaaagaattaaagcatatcaagaaagtattaaacagacgaatcaacagttagaagaa
tcagtggagtgttatgaaatataccatccactagaaagtgtcggtatttatgtgcctggt
ggtaaagcaagttatccttcaacggtattaatgacagcgacgttagcacaagtagcaggt
gtggaaaatattgtcgttgtgacaccacctcaacctaatggtgtgtctcaagaagtatta
gcagcatgctatattacgcaagttgatcaagtatttcaagttggtggtgctcaaagtatt
gctgcgttaacttatggcacagaaacgatacctaaagttgataagattgtaggtccaggc
aatcaatttgttgcatatgccaagaaatatttatttggacaagtaggtattgaccaaata
gctggaccaacagaaatagcacttattattgatgaaacagcagatttagatgccatcgta
tatgatgtttttgcacaagcagaacatgatgaattagcacgtacatatgccattagtgaa
gatgcgcaagtccttaaagatttagaatcacgtattgctaaagcattgcctaatgtggac
agatacgacattgtttctaaaagtatcgctaatcaacactaccttatccatgctagtaat
tttgatgaagcatgccatgtcatgaatacaatcgcgcctgaacatgcgtcgattcaaaca
gtaaatcctcaaccatatattgaaaaagtgaaatatgtgggtgcattgtttattggacat
tattcgccagaggtcataggagattacgttgcaggtccaagtcatgtattacctacaaat
agaacagctagatttaccaatgggttatcggtcaatgatttcttaacacggaacacggtc
atccatttatcaaaagatacgtttgaacaaattgctgattcagcacaacatattgctcat
gttgaagcattatacaatcaccagcagtctattttaatacgtcagtcttag

DBGET integrated database retrieval system