KEGG   Staphylococcus aureus subsp. aureus VC40: SAVC_12265Help
Entry
SAVC_12265        CDS       T01745                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
suv  Staphylococcus aureus subsp. aureus VC40
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAVC_12265
  Amino acid metabolism
   00340 Histidine metabolism
    SAVC_12265
Enzymes [BR:suv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SAVC_12265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2657613..2658863)
Genome map
AA seq 416 aa AA seqDB search
MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHE
QIKAAFDTLDEKTKQALQQSYERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYVPG
GKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVLAACYITQVDQVFQVGGAQSI
AALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDETADLDAIV
YDVFAQAEHDELARTYAISEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASN
FDEACHVMNTIAPEHASIQTVNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTN
RTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAHVEALYNHQQSILIRQS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgcacaacaatttttaaatcaattttcattagaagcaccattagatgagtca
ttgtatccaattattcgcgatatttgtcaggaagttaaagttcatggagataaggctttg
aaaatgtataatctaacattcgatcatacgaaaacagatcatttagaaattagtcatgaa
caaattaaagcagcatttgacacattagatgaaaaaacaaaacaagcattacaacaaagt
tatgaaagaattaaagcatatcaagaaagtattaaacagacgaatcaacagttagaagaa
tcagtggagtgttatgaaatataccatccactagaaagtgtcggtatttatgtgcctggt
ggtaaagcaagttatccttcaacggtattaatgacagcgacgttagcacaagtagcaggt
gtggaaaatattgtcgttgtgacaccacctcaacctaatggtgtgtctcaagaagtatta
gcagcatgctatattacgcaagttgatcaagtatttcaagttggtggtgctcaaagtatt
gctgcgttaacttatggcacagaaacgatacctaaagttgataagattgtaggtccaggc
aatcaatttgttgcatatgccaagaaatatttatttggacaagtaggtattgaccaaata
gctggaccaacagaaatagcacttattattgatgaaacagcagatttagatgccatcgta
tatgatgtttttgcacaagcagaacatgatgaattagcacgtacatatgccattagtgaa
gatgcgcaagtccttaaagatttagaatcacgtattgctaaagcattgcctaatgtggac
agatacgacattgtttctaaaagtatcgctaatcaacactaccttatccatgctagtaat
tttgatgaagcatgccatgtcatgaatacaatcgcgcctgaacatgcgtcgattcaaaca
gtaaatcctcaaccatatattgaaaaagtgaaatatgtgggtgcattgtttattggacat
tattcgccagaggtcataggagattacgttgcaggtccaagtcatgtattacctacaaat
agaacagctagatttaccaatgggttatcggtcaatgatttcttaacacggaacacggtc
atccatttatcaaaagatacgtttgaacaaattgctgattcagcacaacatattgctcat
gttgaagcattatacaatcaccagcagtctattttaatacgtcagtcttag

DBGET integrated database retrieval system