KEGG   Staphylococcus aureus subsp. aureus TW20 (MRSA): SATW20_04710Help
Entry
SATW20_04710      CDS       T02060                                 

Gene name
dfrG
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
suw  Staphylococcus aureus subsp. aureus TW20 (MRSA)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:suw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SATW20_04710 (dfrG)
   00670 One carbon pool by folate
    SATW20_04710 (dfrG)
Enzymes [BR:suw01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SATW20_04710 (dfrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(502263..502760)
Genome map
AA seq 165 aa AA seqDB search
MKVSLIAAMDKNRVIGKENDIPWRIPKDWEYVKNTTKGHPIILGRKNLESIGRALPDRRN
IILTRDKGFTFNGCEIVHSIEDVFELCKNEEEIFIFGGEQIYNLFFPYVEKMYITKIHHE
FEGDTFFPEVNYEEWNEVFAQKGIKNDKNPYNYYFHVYERKNLLS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttctttgattgctgcgatggataagaatagagtgattggcaaagagaatgac
attccttggaggattcccaaggactgggaatatgttaaaaatactacaaagggacatccg
ataatattaggtaggaagaaccttgaatcaatcggaagagccttacctgacagaagaaat
attattctgacgagagataaggggtttacctttaatggttgtgaaattgttcattcaata
gaagatgtttttgagttatgtaaaaacgaagaagaaatttttattttcggaggagaacag
atttataatttgtttttcccttatgttgagaaaatgtacatcacaaaaatacatcatgaa
ttcgaaggagatactttttttccagaagtgaattatgaggaatggaatgaggtatttgcc
caaaaagggataaagaatgataaaaatccgtataactactattttcatgtatatgaaaga
aaaaacttattgagttaa

DBGET integrated database retrieval system