KEGG   Staphylococcus aureus subsp. aureus TW20 (MRSA): SATW20_05480Help
Entry
SATW20_05480      CDS       T02060                                 

Gene name
recR
Definition
(RefSeq) putative recombination protein
  KO
K06187  
recombination protein RecR
Organism
suw  Staphylococcus aureus subsp. aureus TW20 (MRSA)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:suw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SATW20_05480 (recR)
DNA repair and recombination proteins [BR:suw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SATW20_05480 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
581517..582113
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVC
GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
DINIPSLIERLKNDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
EYADEVTLSKAIAGRTEM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaacctatatcaaaacttattgatagctttatgaaattgccaggcatt
ggtccaaagacagcccaacgtctggcttttcataccttagatatgaaagaagacgatgtt
gttcagtttgccaaagcattagtagatgttaagagagaattaacatattgtagcgtatgt
ggtcacattactgaaaatgatccatgttatatttgtgaagataagcaaagagatcgttca
gttatttgtgttgtggaagatgacaaagatgtcatagctatggaaaaaatgagagaatac
aaaggtttatatcacgttttacatgggtctatttcgcctatggatggcattggaccagaa
gatattaatattccttcattgattgaacgcttgaaaaacgatgaagttagcgaattaatc
ttagctatgaacccgaacttagagggggaatctacagccatgtatatttctagattagtt
aagcctataggtatcaaagtgacgagattagcacaagggttatcggtaggtggcgattta
gagtatgctgacgaagtaacattatctaaagcaatcgcaggtagaacagaaatgtaa

DBGET integrated database retrieval system