KEGG   Staphylococcus aureus subsp. aureus TW20 (MRSA): SATW20_05480Help
Entry
SATW20_05480      CDS       T02060                                 

Gene name
recR
Definition
putative recombination protein
Orthology
K06187  
recombination protein RecR
Organism
suw  Staphylococcus aureus subsp. aureus TW20 (MRSA)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:suw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
581517..582113
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVC
GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
DINIPSLIERLKNDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
EYADEVTLSKAIAGRTEM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaacctatatcaaaacttattgatagctttatgaaattgccaggcatt
ggtccaaagacagcccaacgtctggcttttcataccttagatatgaaagaagacgatgtt
gttcagtttgccaaagcattagtagatgttaagagagaattaacatattgtagcgtatgt
ggtcacattactgaaaatgatccatgttatatttgtgaagataagcaaagagatcgttca
gttatttgtgttgtggaagatgacaaagatgtcatagctatggaaaaaatgagagaatac
aaaggtttatatcacgttttacatgggtctatttcgcctatggatggcattggaccagaa
gatattaatattccttcattgattgaacgcttgaaaaacgatgaagttagcgaattaatc
ttagctatgaacccgaacttagagggggaatctacagccatgtatatttctagattagtt
aagcctataggtatcaaagtgacgagattagcacaagggttatcggtaggtggcgattta
gagtatgctgacgaagtaacattatctaaagcaatcgcaggtagaacagaaatgtaa

DBGET integrated database retrieval system