KEGG   Staphylococcus aureus subsp. aureus TW20 (MRSA): SATW20_07740Help
Entry
SATW20_07740      CDS       T02060                                 

Definition
putative phosphofructokinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
suw  Staphylococcus aureus subsp. aureus TW20 (MRSA)
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:suw00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SATW20_07740
Enzymes [BR:suw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     SATW20_07740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
828342..829262
Genome map
AA seq 306 aa AA seqDB search
MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRVLKTLDVESTALGFAG
GFPGKFIIDTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAPGPHITSTQFEQLLQQI
KNTTSEDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAEKELAESVLPYHPLFIKP
NKDELEVMFNTTVNSDTDVIKYGRLLVDKGAQSVIVSLGGDGAIYIDKEISIKAVNPQGK
VVNTVGSGDSTVAGMVAGIASGLTIEKAFQQAVACGTATAFDEDLATRDAIEKIKSQVTI
SVLDGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacagtgactttcaatccttcaattgactatgtcatttttacgaatgatttt
aaaattgatggtttgaacagagcaacagcaacatataaattcgctggggggaaaggtatt
aatgtctcgcgcgtcttaaagacattggatgttgagtcaactgccttgggatttgcaggt
ggatttcctgggaaattcattatagatacattaaataacagtgcaattcaatcgaatttt
attgaagttgatgaagatacacgtattaatgtgaaattaaaaacaggacaagaaacagaa
atcaatgcaccgggtcctcatataacgtcaacacaatttgaacaactgttacaacaaatt
aaaaatacaacaagcgaagatatagttattgttgctggaagtgtaccaagtagtattcca
agcgatgcgtatgcgcaaattgcacaaattacagcacagacaggtgctaaattagtagtc
gacgctgaaaaagaattggctgaaagcgttttaccatatcatccactatttattaaacct
aataaagatgaattagaagtgatgtttaatacaacagtgaactcagacacagatgttatt
aaatatggtcgtttgttagttgataaaggtgcgcaatctgttattgtctcgcttggcggt
gatggtgctatttatattgataaagaaatcagtattaaagcagttaatccacaagggaaa
gtggttaatacagttggctctggtgatagtacagttgcaggcatggtggctggaattgct
tcaggtttaacgattgaaaaagcattccaacaagcagtcgcatgcggtactgccacggca
tttgatgaggacttagcaacacgggacgctatagaaaaaataaaatcacaagttacgatt
agcgtacttgatggggagtga

DBGET integrated database retrieval system