KEGG   Staphylococcus aureus subsp. aureus TW20 (MRSA): SATW20_12390Help
Entry
SATW20_12390      CDS       T02060                                 

Definition
(GenBank) putative CoA synthetase protein
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
suw  Staphylococcus aureus subsp. aureus TW20 (MRSA)
Pathway
suw00020  Citrate cycle (TCA cycle)
suw00640  Propanoate metabolism
suw00660  C5-Branched dibasic acid metabolism
suw01100  Metabolic pathways
suw01110  Biosynthesis of secondary metabolites
suw01120  Microbial metabolism in diverse environments
suw01130  Biosynthesis of antibiotics
suw01200  Carbon metabolism
Module
suw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:suw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SATW20_12390
   00640 Propanoate metabolism
    SATW20_12390
   00660 C5-Branched dibasic acid metabolism
    SATW20_12390
Enzymes [BR:suw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SATW20_12390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: CBI49118
Position
1319214..1320380
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
KIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQ
VTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKF
LLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHKDVVELRDLEEEDP
KEIEASKHDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDAGGSATREKVTE
AFKIILGDENVKGIFVNIFGGIMKCDVIAEGIVEAVKEVDLTLPLVVRLEGTNVELGKKI
LKDSGLAIEPAATMAEGAQKIVKLVKEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcaaggtaaagaaatatttcgttcaatgggcgttgcagttcca
gaaggacgagtagcatttactgctgaagaagcggtggagaaagcaaaagaattaaattct
gatgtttatgttgtaaaagcacaaattcatgctggaggtagaggtaaagcaggcggagta
aaaattgctaaatctttatctgaggtagaaacatatgcaaaagaattattagggaaaact
ttggtgacacatcaaactggtccagaaggtaaagaaattaagcgtttatatatcgaagaa
ggttgtgctattcaaaaagaatattacgttggattcgttattgatcgtgcgactgaccaa
gtaacattgatggcgtctgaagaagggggcactgagattgaagaagttgctgcgaagact
cctgaaaagatcttcaaagaaactatcgatccagtaatcggactttcaccattccaagca
agacgaattgcgtttaatattaatattcctaaagaatctgttaacaaagctgctaaattc
ttattagcactttataatgtattcattgaaaaagattgttcaatcgtagaaatcaaccca
ttagttacaacagctgatggtgatgtattggcattagatgctaaaattaattttgatgat
aatgcattattcagacataaagatgttgtagaattacgtgatttagaagaagaagatccg
aaagagattgaagcgtctaaacatgatttatcatacattgcattagatggtgacatcgga
tgtatggttaatggtgcaggtttagccatggcaacaatggatacgattaatcatttcggt
ggaaacccagccaatttcttagatgcaggcggaagcgctactagagaaaaagtaactgaa
gcatttaaaatcattttaggtgatgaaaatgttaaaggtatttttgtaaacattttcggt
ggcattatgaaatgtgatgttatcgcagaaggtatcgttgaagctgtaaaagaagtagat
ttaactttaccactagttgtacgcctagaaggtacaaatgttgagttaggtaaaaaaatc
ttaaaagactcaggattagcaattgaaccagcagcaacaatggctgaaggtgcacaaaaa
attgttaaactagtcaaagaagcataa

DBGET integrated database retrieval system