KEGG   Staphylococcus aureus subsp. aureus TW20 (MRSA): SATW20_18260Help
Entry
SATW20_18260      CDS       T02060                                 

Gene name
hemY
Definition
(GenBank) putative protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
suw  Staphylococcus aureus subsp. aureus TW20 (MRSA)
Pathway
suw00860  Porphyrin and chlorophyll metabolism
suw01100  Metabolic pathways
suw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SATW20_18260 (hemY)
Enzymes [BR:suw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SATW20_18260 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SATW20_18260 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 MCRA Pyr_redox Thi4 HI0933_like NAD_binding_9 FAD_binding_2 Mqo FAD_binding_3 Glu_dehyd_C Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CBI49700
Position
complement(1986520..1987920)
Genome map
AA seq 466 aa AA seqDB search
MTKSVAIIGAGITGLSSAYFLKQQDPNIDVTIFEASNRPGGKIQSYRKDGYMIELGPESY
LGRKTIMTELAKDIGLEQDIVTNTTGQSYIFAKNKLYPIPGGSIMGIPTDIKPFVTTKLI
SPLGKLRAGFDLLKKPTQMQDGDISVGAFFRARLGNEVLENLIEPLMGGIYGTDIDKLSL
MSTFPNFKEKEEAFGSLIKGMKDEKNKRLKQRQLYPGAPKGQFKQFKHGLSSFIEALEQD
VKNKGVTIRYNTSVDDIITSQKQYKIVYNDQLEEVYDGVLVTTPHQVFLNWFGQDPAFDY
FKTMDSTTVATVVLAFDEKDIENTHDGTGFVIARTSDTDITACTWTSKKWPFTTPEGKVL
IRAYVGKPGDTVVDDHTDNELVSIVRRDLSQMMTFKGDPEFTIVNRLPKSMPQYHVGHIQ
QIRQIQAHIKQTYPRLRVTGASFEAVGLPDCITQGKVAAEEVIAEL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaatcagtggctattataggagcggggataacaggtttatcaagtgcatatttt
ttaaaacagcaagatcctaatattgatgtaaccatctttgaagcatcgaatcgtccgggg
ggaaagattcaatcgtatcgtaaagatggttatatgattgaactagggcctgaatcttat
ttaggtagaaaaacgattatgacagaattagcgaaagatattggattagaacaagatatt
gttacaaatacgactggacaatcatatatttttgcgaaaaataaattatatccgattcca
ggtggttcaattatgggtattccaacagatattaaaccatttgttactacaaaattaata
tcgccacttggtaaattaagagcagggtttgatttattaaaaaaacctactcaaatgcag
gatggtgacatttctgttggtgcatttttcagagcaagattaggtaatgaggtacttgag
aatttaatagagcctttaatgggtggtatttatggtaccgatattgataaattaagtttg
atgagtacgtttcctaattttaaagaaaaagaagaggcattcggaagtctgataaaaggt
atgaaggatgagaaaaataagcgtctgaaacaaagacaattatatcctggcgcaccgaaa
ggacaattcaaacaatttaagcatggtttaagctcatttattgaagcattagaacaagat
gttaaaaataaaggtgtgacaatacgctacaatacgtcagtggatgatataattacatct
caaaaacaatataaaattgtttacaatgatcaactagaagaagtgtatgatggcgtatta
gtaacgacaccacatcaagtgtttttaaattggttcggacaagatccagcatttgattac
tttaaaacgatggatagtacgactgttgcaactgttgtattggcatttgatgaaaaagac
attgaaaatacccatgatggtactggcttcgtaattgcgagaacgagtgatacagacatt
accgcatgtacttggacatcgaaaaaatggccatttactacaccggaaggtaaggttttg
attcgtgcgtatgtaggtaaaccaggtgatactgtggttgatgatcatacagataatgaa
ttagtatcgattgtacgtagagatttaagtcaaatgatgacatttaaaggtgatcctgaa
tttacaattgtcaatcgtttgccgaaaagtatgccacagtaccatgtcggtcatattcaa
caaattagacagattcaagcacatattaaacaaacatatccacgacttagagtaactggt
gcatcttttgaagcggttggactacctgattgtattacgcaaggtaaagttgctgctgaa
gaagtaatcgcagagttgtaa

DBGET integrated database retrieval system