KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_02260Help
Entry
SAEMRSA15_02260   CDS       T02059                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sux00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
284078..285514
Genome map
AA seq 478 aa AA seqDB search
MTKLPQNFMWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKARQITESIDPNHYYPNH
EGIDFYHRYKEDIALFKEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQ
GIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFERYKDKVTYWMTFNEINNQ
MDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISH
VPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDFGWQEGDDSIL
QQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRY
TLNVLYDRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEYLKVHITAAIEAVDQDGVDLIG
YTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMERLKKDSFYWYKQVIASNGDKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattaccgcaaaattttatgtggggtggcgctcttgccgcaaatcaatttgaa
ggtggatatgataaaggtggcaaaggattaagtgtaattgatgttatgacgagtggtgca
catggcaaagcacgtcagattacagaatctatagatccaaatcactattatccaaatcat
gaaggtattgatttttatcatcgttataaggaagatattgccttgtttaaagaaatggga
ttgaaatgtttacgtacgtcgattgcgtggacacgtatctttccgaatggggatgaagat
gtgccaaatgaagaaggacttgccttttatgatcgtatctttgatgaattaattgcacaa
ggtattgaacctgttgtgacgttatcacattttgagatgccacttcatttagcgaaacat
tatggtggatttagaaatagagaagttgtcgattattttgtgcattttgcgcgtgttgta
tttgaaagatataaagataaagtgacatattggatgacgtttaatgaaattaataatcag
atggacacatcaaatcctatctttttatggacaaattctggggtagcattaacagaaaat
gataatcccgaagaagtcttgtatcaagtagcacatcatgaacttttagccagtgcttta
gcggttcgtcttggtaaagagattaatccgaaatttaagattggaacaatgatttcacat
gtacccatttatccatattcgtgtcatccgaaagatatgatggaagcacaaattgcgaat
cgcttacgtttctttttcccggatgttcaagtaagaggttattatccaagctatgctaaa
aaaatgttggcacgaaaaggatatgattttggatggcaagaaggggacgacagtatttta
cagcagggcacggttgattatattggctttagttattacatgtctacggctgtaaaacat
gatgttgatactacagttgaaaacaacatcgtcaacggtggtttgaatcattctgtggag
aatccgcatatcgcaacgagtgattggggttgggcgattgatccagatggcttaagatat
acattgaatgtgttatatgatcgttatcagttgccactttttattgtggaaaatggtttt
ggtgcagttgatgaagtggtagatggacatattcatgatgattatcgcattgaatattta
aaagtacatattacagcagcgatagaagcagttgatcaagatggtgtagatttaatcggt
tatacgccgtggggaatcattgatattgtttcatttacaactggtgaaatgaagaaacgc
tatggtttaatatatgttgatcgagataatgatggtcatggcacgatggaacgcttgaaa
aaagattcgttctattggtataaacaagtgatagcatcaaatggagataaattataa

DBGET integrated database retrieval system