KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_04060Help
Entry
SAEMRSA15_04060   CDS       T02059                                 

Gene name
recR
Definition
putative recombination protein
Orthology
K06187  
recombination protein RecR
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sux00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SAEMRSA15_04060 (recR)
DNA repair and recombination proteins [BR:sux03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SAEMRSA15_04060 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
472991..473587
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVC
GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
DINIPSLIERLKSDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
EYADEVTLSKAIAGRTEM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaacctatatcaaaacttattgatagctttatgaaattgccaggcatt
ggtccaaagacagcccaacgtctggcttttcataccttagatatgaaagaagacgatgtt
gttcagtttgccaaagcattagtagatgttaaaagagaattaacatattgtagcgtatgt
ggtcacattactgaaaatgatccatgttatatttgtgaagataagcaaagagatcgttca
gttatttgtgttgtggaagatgacaaagatgtcatagctatggaaaaaatgagagaatac
aaaggtttatatcacgttttacatgggtctatttcgcctatggatggcattggaccagaa
gatattaatattccttcattgattgaacgcttaaaaagcgatgaagttagcgaattaatc
ttagctatgaacccgaacttagagggggaatctacagccatgtatatttctagattagtt
aagcctataggtatcaaagtgacgagattagcacaagggttatcggtaggtggcgattta
gagtatgctgacgaagtaactttatctaaagcaatcgcaggtagaacagaaatgtaa

DBGET integrated database retrieval system