KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_04210Help
Entry
SAEMRSA15_04210   CDS       T02059                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAEMRSA15_04210
Enzymes [BR:sux01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SAEMRSA15_04210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492501..493349
Genome map
AA seq 282 aa AA seqDB search
MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKRKDRKIVVEIEHNYVP
SNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSADAAATLRGLNRLFDIGA
SLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSAWVILAKPNLGISSPDIF
KLINLDKRYDVHTKMCYEALENRDYQQLCQSLSNRLEPISVSKHPQIDKLKNNMLKSGAD
GALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgaaacggcaccagccaaaattaattttacgctcgatacactttttaaaaga
aatgatggctatcatgagattgaaatgataatgacaacagttgatttaaatgatcgttta
acttttcataaaagaaaagatcgaaagatagttgttgagattgaacataattatgtgcct
tctaatcataaaaatctcgcatatcgtgcagcgcaactatttattgagcaatatcaacta
aagcaaggtgtaacaatttctatcgataaagaaatacctgtttctgctggcttagctgga
ggttcggctgatgcagcagcaactttaagaggattgaatcgactttttgatataggggcg
agtttggaagaattggctctactaggcagtaaaatcgggacagatattccgttttgtatt
tataataaaactgcactatgtactggaagaggagagaaaatcgagtttttaaataaacca
ccttcagcttgggtgattcttgctaaaccaaacttaggcatatcatcaccagatatattt
aagttgattaatttagataagcgttacgacgtacatacgaaaatgtgttatgaggcctta
gaaaatcgagattatcaacaattatgtcaaagtttgtctaatcgattagagccaatttct
gtttcaaaacacccacaaatcgataaattaaaaaataatatgttgaaaagtggtgcagat
ggtgcgttaatgagtggaagcggacctactgtgtatgggctagcacgaaaagaaagccaa
gcaaaaaatatttataatgcagttaacggttgttgtaatgaagtgtacttagttagacta
ttaggatag

DBGET integrated database retrieval system