KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_04400Help
Entry
SAEMRSA15_04400   CDS       T02059                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAEMRSA15_04400 (folP)
Enzymes [BR:sux01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SAEMRSA15_04400 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
513649..514452
Genome map
AA seq 267 aa AA seqDB search
MTKTKIMGILNVTPDSFSDGGKFNNVESAVTRVKAMMDEGADIIDVGGVSTRPGHEMVSL
EEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGLYDHHMFQIVAK
YDAEIILMHNGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEA
EVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAVRV
HNVELNAKLAKGIDFLKENENARHNLS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacaaaaattatgggcatattaaacgtcacacctgattcattctcagatggt
ggaaaatttaataatgttgaatcagcagtaactagagtgaaagcgatgatggatgaaggt
gctgacattatagatgttggaggtgtttcaacgagacccggccatgaaatggtttcatta
gaagaagagctgaacagagtattacctgttgttgaagctattgtcggttttgatgtgaaa
atttcagtcgatacatttcgaagtgaggttgctgaagcatgtttaaaattaggcgttgat
atcattaatgatcaatgggcggggctgtatgatcatcatatgttccaaattgtagctaaa
tatgacgcggaaattattttaatgcataatggaaatggtaatcgtgatgaaccggttgtc
gaagaaatgttaacatctttgttagcacaagcacatcaagctaaaatagctggtatacct
tcaaataaaatttggctagatccaggtataggtttcgctaaaactagaaatgaagaagcc
gaagttatggcaagactggatgaacttgttgcaacagaatatccagttttattagcgaca
agccggaaacgtttcactaaagagatgatgggttatgatacaacaccggttgaaagagat
gaagtaactgcagctacgactgcatatggtattatgaaaggcgttagagcagtacgcgtt
cataatgtcgagttgaatgctaaattagctaaaggtatagattttttaaaggagaatgaa
aatgcaagacacaatctttcttaa

DBGET integrated database retrieval system