KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_07010Help
Entry
SAEMRSA15_07010   CDS       T02059                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAEMRSA15_07010 (tpiA)
   01230 Biosynthesis of amino acids
    SAEMRSA15_07010 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAEMRSA15_07010 (tpiA)
   00051 Fructose and mannose metabolism
    SAEMRSA15_07010 (tpiA)
   00562 Inositol phosphate metabolism
    SAEMRSA15_07010 (tpiA)
Enzymes [BR:sux01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAEMRSA15_07010 (tpiA)
Exosome [BR:sux04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAEMRSA15_07010 (tpiA)
  Exosomal proteins of bladder cancer cells
   SAEMRSA15_07010 (tpiA)
  Exosomal proteins of melanoma cells
   SAEMRSA15_07010 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
808468..809229
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDKEINKKAHAIFK
HGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSENQLKSVVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagctggtaactggaaaatgaacaaaacagtacaagaagcaaaa
gacttcgtcaatgcattgccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcgttcacaggtgaaacg
tctccagttgcattagcagatttaggcgttaaatacgttgttatcggtcattctgaacgt
cgtgaattattccacgaaacagataaagaaattaacaaaaaagcgcacgctattttcaaa
catggaatgactccaattatatgtgttggtgaaacagacgaagagcgtgaaagtggtaaa
gctaacgatgttgtaggtgagcaagttaagaaagctgttgcaggtttatctgaaaatcaa
ctaaaatcagttgtaattgcttatgaaccaatctgggcaatcggaactggtaaatcatca
acatctgaagatgcgaatgaaatgtgtgcatttgtacgtcaaactattgctgacttatca
agcaaagaagtatcagaagcaactcgtattcaatatggtggtagtgttaaacctaacaac
attaaagaatacatggcacaaactgatattgatggggcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system