KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_10420Help
Entry
SAEMRSA15_10420   CDS       T02059                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sux00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1160087..1160710
Genome map
AA seq 207 aa AA seqDB search
MDNEKGLLIVLSGPSGVGKGTVRKRIFEDPSTSYKYSISMTTRQMREGEVDGVDYFFKTR
DAFEALIKDDQFIEYAEYVGNYYGTPVQYVKDTMDEGHDVFLEIEVEGAKQVRKKFPDAL
FIFLAPPSLDHLRERLVGRGTESDEKIQSRINEARKEVEMMNLYDYVVVNDEVELAKNRI
QCIVEAEHLKRERVEAKYRKMILEAKK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggataatgaaaaaggattgttaatcgttttatcaggaccatctggagtaggtaaaggt
actgttagaaaacgaatatttgaagatccaagtacatcatataagtattctatttcaatg
acaacacgtcaaatgcgtgaaggtgaagttgatggcgtagattacttttttaaaactagg
gatgcgtttgaagctttaatcaaagatgaccaatttatagaatatgctgaatatgtaggc
aactattatggtacaccagttcaatatgttaaagatacaatggacgaaggtcatgatgta
tttttagaaattgaagtagaaggtgcaaagcaagttagaaagaaatttccagatgcatta
tttattttcttagcacctccaagtttagatcacttgagagagcgattagtaggtagagga
acagaatccgatgagaaaatacaaagtcgtattaacgaagcacgtaaagaagtcgaaatg
atgaatttatacgattacgttgtagttaatgatgaagtagaacttgcgaagaatagaatt
caatgtattgtagaagctgagcacttaaaaagagagcgcgtagaagctaagtatagaaaa
atgattttggaggctaaaaaataa

DBGET integrated database retrieval system