KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_12890Help
Entry
SAEMRSA15_12890   CDS       T02059                                 

Gene name
dfrB
Definition
dihydrofolate reductase type I
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAEMRSA15_12890 (dfrB)
   00670 One carbon pool by folate
    SAEMRSA15_12890 (dfrB)
Enzymes [BR:sux01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SAEMRSA15_12890 (dfrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1424362..1424841)
Genome map
AA seq 159 aa AA seqDB search
MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITAIEGKFRG
DTFFPPYTFEDWEVTSSVEGKLDEKNTIPHTFLHLIRKK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactttatccattctagttgcacatgacttgcaacgagtaattggttttgaaaatcaa
ttaccttggcacctaccaaatgatttgaagcatgttaaaaaactatcaacaggtcatact
ttagtaatgggtcgtaagacatttgaatcgattggtaaaccactaccgaatcgtcgaaat
gttgtacttacttcagatacaagtttcaacgtagagggcgttgatgtgattcattctatt
gaagatatttaccaactaccgggacatgttttcatatttggagggcaaacattatttgaa
gaaatgattgataaagtggacgacatgtatattactgctattgaaggtaaattccgtggt
gatacgttcttcccaccttatacatttgaagactgggaagttacctcttcagttgaaggt
aaactagatgagaaaaatacaattccacatacctttctacatttaattcgtaaaaaataa

DBGET integrated database retrieval system