KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_15800Help
Entry
SAEMRSA15_15800   CDS       T02059                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
sux00860  Porphyrin and chlorophyll metabolism
sux01100  Metabolic pathways
sux01110  Biosynthesis of secondary metabolites
sux01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAEMRSA15_15800 (hemD)
Enzymes [BR:sux01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SAEMRSA15_15800 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: CCG16291
Position
complement(1733279..1733947)
Genome map
AA seq 222 aa AA seqDB search
MKPVVVMTQTNDMQSDLVSIIHKPFIDIKPLNFDIHLLNQRYDWLVFSSKNAVKFFYKYL
KGINVDNIAVIGSKTAQYCESLGIRVDFMPNDFSQEGFLKSFNQTNQKILLPSSELARPL
LLAALSKNNEVVKIDLYTSVPNKQNIQDVKEMIEHQQIDALTFSSSSAVRYYFNEGFVPK
FKSYFAIGEQTARTIKSYQQPVTIAEIQTLESLIEKILESRG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagttgtagttatgacacaaacaaatgacatgcaaagtgatttagtatcaatt
attcacaaaccctttattgatataaagccactaaattttgatattcatttgttaaatcaa
cgctatgactggcttgttttttcatctaaaaatgctgtgaaattcttttataaatatcta
aaaggaattaatgttgataacattgctgtgataggaagtaagacagcgcaatattgtgaa
tcacttggcattcgagttgattttatgccaaacgacttttctcaagaaggatttttaaaa
tcatttaatcaaactaaccaaaaaatacttttgccttcgagtgaattggcgagaccattg
ttattagcagcgttatctaaaaataatgaagttgttaaaatagatttatatacttcagtg
cctaacaaacaaaatatacaagatgttaaagaaatgatagaacatcaacaaatcgatgca
ttaacattttcaagttcgtcggcagtacgttattattttaatgaaggatttgtaccaaaa
ttcaagtcgtattttgctattggagaacaaacagcacggaccattaaatcatatcaacaa
ccagtaacaattgcagaaattcaaacactcgaatcactaattgaaaagattttagaaagt
aggggctaa

DBGET integrated database retrieval system