KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_15990Help
Entry
SAEMRSA15_15990   CDS       T02059                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sux03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1753148..1754020)
Genome map
AA seq 290 aa AA seqDB search
MPELPEVEHVKRGIEPYVINQKIEHVKFSDKVIEGKAQGKETIIKGIELDTFKTLSEGYT
ITNVERRSKYIVFQLDNKREQRTLISHLGMAGGFFIVDELEDIMIPNYRKHWHVIFELSN
DKKLIYSDIRRFGEIRNVASVASYPSFLEIAPEPFSNEALTYYLNRIHQQSNKNKPIKQV
ILDHKVIAGCGNIYACEALFRAGVLPDKKVKDLTHQQQEMVFYYVREVLEEGIKYGGTSI
SDYRHADGKTGEMQLHLNVYKQPVCKVCGSQIETKIIATRNSHYCPVCQK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattaccagaagtagaacatgtaaaaagaggaattgaaccctacgttataaat
caaaaaattgaacacgttaaattttcggataaagtaattgaaggtaaagctcaaggcaag
gaaacaattataaaaggaattgaattagatacttttaaaactttatcggaaggctatacc
attacaaatgtagaacgaagaagtaaatatatcgtttttcagctagataataaacgagaa
caacgtacattaattagtcatttaggtatggcgggtggttttttcattgtagatgaactt
gaagatattatgatacctaattatcgtaagcattggcatgttatttttgagttgtcaaat
gacaaaaagttaatttattcagatatacggcgttttggagaaattagaaatgttgcgtct
gtagcatcttacccttcatttttagaaatagcgcctgaacctttttcaaatgaagcattg
acgtattatttaaatcgaattcatcaacagtctaataagaataaaccaatcaaacaagtg
attttggatcataaagtaatcgcaggttgtggaaatatttacgcatgtgaagcgttgttt
cgtgcaggtgttttaccagataaaaaagtaaaagacttaacacaccaacaacaagaaatg
gttttttattatgttagagaagtactagaagaaggtattaaatatggcggtacaagtatt
tcagattatcgtcatgctgatggaaaaactggtgagatgcaattgcatcttaatgtatat
aagcagccggtatgcaaagtgtgtggaagtcaaattgaaacaaaaatcatcgcgacaaga
aatagtcattattgtccagtatgtcaaaaataa

DBGET integrated database retrieval system