KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_16590Help
Entry
SAEMRSA15_16590   CDS       T02059                                 

Definition
putative peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAEMRSA15_16590
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAEMRSA15_16590
Enzymes [BR:sux01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SAEMRSA15_16590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1832843..1834252)
Genome map
AA seq 469 aa AA seqDB search
MWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTT
HDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPT
IAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIH
GEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFE
YFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFV
AFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKA
MDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNDMTEPYTIGGGTYAR
NLDKGVAFGAMFSDSEDLMHQKNEYITKKQLFNATSIYLEAIYSLCVEE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaagaaaaagttcaacaatacgaagatcaaatcattaatgacttaaaaggatta
ttagcaattgaaagtgtgagagatgatgcgaaagcatcagaagacgcaccagttggtcca
ggtcctcgtaaggcattagactacatgtatgaaattgcacatagagatggatttacaaca
catgatgtggatcatattgcaggaagaattgaggcaggtaaaggaaatgacgtattaggt
atcttatgtcatgttgacgttgttcctgctggtgatggatgggatagtaatccgtttgag
ccggttgtaacagaagatgctatcatagctagaggtacacttgatgacaaaggtccaaca
attgctgcttattatgcaattaagatattagaagatatgaatgtggattggaagaaacgt
attcatatgattattggtacggatgaagaatctgattggaaatgtacggatcgctatttt
aaaacagaagaaatgccaacattaggttttgcaccagatgcagaatttccgtgtattcat
ggtgaaaaaggcattacaacatttgatttagttcaaaataaacttactgaagatcaagat
gaacctgattatgaattaataactttcaaatctggtgaacgttacaacatggtacctgat
catgcagaagcaagagtgcttgttaaagaaaatatgacagatgttattcaagactttgag
tactttttagaacaaaatcatttacaaggtgatagtactgttgatagtggcattctagtt
ttaacagttgaaggtaaagcggttcatggtatggatccatctatcggtgtgaatgcgggt
ctttacttactaaaattcttagcatcattaaatcttgataataatgcacaagcgtttgta
gcatttagtaatcgctacttatttaattcagattttggtgaaaagatgggaatgaaattc
catacagatgtcatgggtgatgtgacaactaacattggtgttattacatatgataatgaa
aatgcaggtcttttcggtatcaatttaagatatcccgaaggatttgaatttgaaaaagct
atggatcgttttgcaaatgagattcaacaatatggctttgaagtgaaattaggtaaagtc
caaccaccacattatgttgataaaaatgatccttttgtacaaaagttagttactgcatat
agaaatcaaacaaatgatatgactgaaccttatactataggtggcggtacttatgcgaga
aacttagacaagggtgtagcatttggcgcaatgtttagtgattctgaagatttaatgcat
caaaaaaatgaatatatcactaaaaaacagttatttaatgcaactagtatttatttagaa
gcaatttattcattatgtgtggaggaataa

DBGET integrated database retrieval system