KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_20700Help
Entry
SAEMRSA15_20700   CDS       T02059                                 

Gene name
rocF
Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAEMRSA15_20700 (rocF)
  Amino acid metabolism
   00220 Arginine biosynthesis
    SAEMRSA15_20700 (rocF)
   00330 Arginine and proline metabolism
    SAEMRSA15_20700 (rocF)
Enzymes [BR:sux01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SAEMRSA15_20700 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2250636..2251544)
Genome map
AA seq 302 aa AA seqDB search
MTKTKAIDIIGAPSTFGQRKLGVDLGPTAIRYAGLIPRLKQLDLDVNDKGDIKVSAVDIE
KFQSEQNGLRNYDEIIDVTQKLNKEVSASIENNRFPLVLGGDHSIAVGSVSAISKHYNNL
GVIWYDAHGDLNIPEESPSGNIHGMPLRILTGEGPKELLEFNINTIKPENIVLIGMRDLD
KGERQFIKDKNIKTFTMADIDKLGIQTVIENTLDYLKTHNVDGIHLSLDVDALDPLETPG
TGTRVLGGLTYRESHFALELLHQSQSVTSMDLVEVNPLIDSNNHTAEQAVSLVGTFFGET
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagacaaaagcaattgatattattggtgcaccatcaacatttggacaaagaaaa
ttaggtgttgatttaggaccaactgcgattagatatgcaggtttaataccaagactaaag
caattagaccttgatgtcaatgacaaaggggatattaaggtatcagctgtagacattgaa
aaatttcaaagtgaacaaaatggattaagaaactacgatgaaattatagatgttactcaa
aaattaaataaagaagtttcagcatcaattgaaaataacagatttcctctagttcttggt
ggagatcattctattgcggtaggttcagtatcagcaataagtaaacattataataattta
ggtgttatttggtatgatgcacatggtgatttaaatatacctgaagagtcaccaagtgga
aatattcatggtatgccacttcggattttgacaggtgaaggaccaaaggaactattagaa
ttcaatattaataccattaaacctgaaaatattgtgctaattggtatgagagatttggat
aaaggtgaacgacaatttattaaagataaaaatattaaaacatttactatggctgacata
gataaactaggaattcagactgtaattgaaaatacattagattatttaaaaactcataat
gtagatggtatacatttatctcttgacgttgatgccttagatccacttgaaacgccaggc
acaggtacaagagtattaggtggacttacatatagagaaagtcattttgcgctggaatta
ttacatcagtctcaatcagtaacatcaatggatttagttgaagtaaatccattgattgac
agtaataatcatactgctgaacaagcggtttcattagttggaacatttttcggtgaaact
ttattataa

DBGET integrated database retrieval system