KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_23980Help
Entry
SAEMRSA15_23980   CDS       T02059                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAEMRSA15_23980 (gtaB)
   00052 Galactose metabolism
    SAEMRSA15_23980 (gtaB)
   00500 Starch and sucrose metabolism
    SAEMRSA15_23980 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    SAEMRSA15_23980 (gtaB)
Enzymes [BR:sux01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SAEMRSA15_23980 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2590077..2590943)
Genome map
AA seq 288 aa AA seqDB search
MKKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRH
KRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQF
IGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNG
RQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNND
NQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKELGL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataaaaaaggcaatcattcccgctgctggtttagggactagatttttacca
gcaactaaagcgatgccaaaggaaatgcttcctatcttagataaacccacaatacaatat
atcgttgaagaagctgcaagagctggaattgaagatattattatagtgacaggtcgccac
aaacgcgcgattgaagatcattttgatagtcaaaaagaattagaaatggtgttaaaagaa
aaaggtaaatctgagttactagaaaaagttcagtattcaacagaacttgcgaatattttt
tatgtaaggcagaaagaacaaaaaggtttagggcatgcgattagttctgcgcgtcaattt
atcggcaatgaaccatttgcggtattattaggtgacgatattgttgaatctgaagtgcca
gcagtgaaacagttgattgacgtttatgaagaaacagggcactcagttataggtgtccaa
gaagttccggaagcagatactcatcgttatgggattattgacccattaactaaaaacgga
cgtcagtatgaagtgaaaaagtttgttgaaaagccagcacaaggtacggcaccatcaaac
ctagctattatgggacgttatgtattaacgcctgaaattttcgattatttaaaaacgcaa
aaagaaggcgcaggtaacgaaattcagttaacagatgcgattgaacgtatgaataatgat
aaccaagtgtatgcatatgacttcgaaggcgaacgttatgacgttggagaaaaattaggc
ttcgttaaaacaacgatagaatatgcattgaaagatgacagtatgcgagaagaattaaca
cgatttattaaagaattagggttataa

DBGET integrated database retrieval system