KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_24140Help
Entry
SAEMRSA15_24140   CDS       T02059                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
sux00010  Glycolysis / Gluconeogenesis
sux00030  Pentose phosphate pathway
sux00051  Fructose and mannose metabolism
sux00680  Methane metabolism
sux01100  Metabolic pathways
sux01110  Biosynthesis of secondary metabolites
sux01120  Microbial metabolism in diverse environments
sux01130  Biosynthesis of antibiotics
sux01200  Carbon metabolism
Module
sux_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAEMRSA15_24140
   00030 Pentose phosphate pathway
    SAEMRSA15_24140
   00051 Fructose and mannose metabolism
    SAEMRSA15_24140
  Energy metabolism
   00680 Methane metabolism
    SAEMRSA15_24140
Enzymes [BR:sux01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SAEMRSA15_24140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 GP24_25
Motif
Other DBs
NCBI-ProteinID: CCG17125
Position
2609992..2611956
Genome map
AA seq 654 aa AA seqDB search
MTQITERELKKKYLDLLSQHFDTPEKLATEIINLESILELPKGTEHFVSDLHGEYEAFQH
VLRNGSGNVRAKINDIFKDKLSTKELNDLTALVYYPEDKLQLIKCDFQNYGQLNVWYITT
IEHLIQLIKYCSSKYTRSKLRRALPEQYVFIVEELLYKNNEFKNKKSYYETLVNQVIELK
QADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYHSLDIQWGNHDVLWVG
AYAGSKVCLANLLRICARYDNLDIVEDAYGINLRPLLTLAEKYYDADNPAFKPKKRPDKH
ERLTQREESQITKIHQAIAMIQFKLEIPVIKRRPNFEMDERLVLEKVNYDTNEITVYGKT
YPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRKGSLYLPYNGN
LLIHGCIPVDENGEMESFEIDGQTYSGQELLDVFEYHVRKSFDEKENTDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVRKMLSDFGLNPDEGRI
INGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQQFN
AKEKILSEGIDELSIKRIVDKELQRKKIRNTNKGKELQAQIDILKMLMHDRYLD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaattactgaaagagaattaaaaaagaaatatttggatttattatctcaacat
ttcgatactccagaaaagcttgcgactgaaattattaatttagaatctattctagaattg
cctaaaggtacggagcatttcgtcagcgatttacatggtgaatatgaagctttccaacac
gtattacgcaacggttctgggaacgtgcgagcgaaaatcaatgatattttcaaagacaag
ttatcaacgaaagaacttaacgatttgactgcccttgtttactatccagaagacaaattg
cagcttattaaatgcgattttcaaaattacggacaattaaatgtttggtatattacgacg
attgaacatctcattcagctaattaaatattgttcttcaaaatatacgcgttcaaaactt
cgacgtgccttgccggagcaatacgttttcatcgtagaagagttattatataaaaacaac
gaattcaaaaataaaaaatcttactacgaaacacttgtaaatcaagtgattgagcttaag
caagcggatgatttaattatagggcttgcgtattctgtacaacgcttagtcgtcgatcat
ttacacgttgtcggcgatatttatgatcgtggcccgcaaccagataaaatcatggacacg
ctgattaattatcattctctggatattcaatggggtaatcatgatgtgctatgggttggt
gcttatgcagggtctaaagtatgtttagctaatttactacgtatttgtgcacgttatgac
aatctagatatcgttgaagatgcttacggtattaatttaagacctttgctaacattagcc
gaaaaatactatgatgcagataatcctgcttttaaacctaaaaaaagacctgataaacat
gaacgtttaacacaacgcgaagaaagtcagattactaaaattcatcaagctattgcgatg
attcaattcaaactggaaataccggttattaagcgccgtccaaactttgaaatggacgaa
cgacttgtacttgaaaaagttaattacgatactaatgaaataacagtatacggaaaaaca
tatccattaaaagatacatgcttccaaactgttaaccgtgataacccagcagaattacta
cctgaagaagaagaagtcatgaataaactattattgtcattccagcaatctgaaaaatta
cgtcgtcatatgtctttcttgatgcgtaaaggctcactttacttaccttataatggcaat
ttactcattcatggttgtattccagttgatgaaaatggtgagatggaatcattcgaaatt
gatggtcagacatacagtggccaagagttattagatgtgtttgaatatcatgtccgtaaa
tcatttgatgaaaaagaaaatactgatgacttatccactgatttagtttggtatttatgg
actgggaaatattcttcactatttggtaaacgtgcgatgactacgtttgagcgatatttt
attgcagataaagcttctcataaagaagaaaaaaacccgtactatcatctacgtgaagat
gtgaatatggttcgtaaaatgctcagtgattttggattaaatccagatgaaggacgcatt
attaatggtcacacaccagtgaaagaaattaatggcgaagatcctatcaaggctgatgga
aaaatgcttgtcattgatggtggcttttcaaaagcttatcagtcaacaactggcattgca
ggttatacattgttgtataattcattcggaatgcaactcgttgcacatcaacaatttaac
gcaaaagaaaaaattctttccgaaggtatcgacgaactgtcaattaaacggattgttgat
aaagaattgcaacgtaaaaaaatccgtaatacaaataaaggtaaagagcttcaagctcaa
atagatattttgaaaatgttaatgcatgatcgttacttagactaa

DBGET integrated database retrieval system