KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_25130Help
Entry
SAEMRSA15_25130   CDS       T02059                                 

Definition
(GenBank) putative AMP-binding enzyme
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
sux00010  Glycolysis / Gluconeogenesis
sux00620  Pyruvate metabolism
sux00640  Propanoate metabolism
sux00680  Methane metabolism
sux01100  Metabolic pathways
sux01110  Biosynthesis of secondary metabolites
sux01120  Microbial metabolism in diverse environments
sux01130  Biosynthesis of antibiotics
sux01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sux00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAEMRSA15_25130
   00620 Pyruvate metabolism
    SAEMRSA15_25130
   00640 Propanoate metabolism
    SAEMRSA15_25130
  Energy metabolism
   00680 Methane metabolism
    SAEMRSA15_25130
Enzymes [BR:sux01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SAEMRSA15_25130
Lipid biosynthesis proteins [BR:sux01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAEMRSA15_25130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Atu4866
Motif
Other DBs
NCBI-ProteinID: CCG17221
Position
complement(2710077..2711696)
Genome map
AA seq 539 aa AA seqDB search
MYERKLVMQKSALFAPEKYNIISEIEKYSHIPDKKAILYHNTEGEDISVTYQQLIEQSNK
VGNVLASHGLSKGDKVLIMMPRSIATYELYIAALKLGVAIIPCSEMLRTKDLQYRITHGE
INAVIALEPFTVEFEKIKGYDALTKFVIAGQKDGWISLEAEKENASNKLEMADTTRDDTA
ILSYTSGTTGNPKAVTHCHGWGFAHLQMAPKHWLCINEDDLVWATAAPGWQKWVWSPFLS
VLGSGATAFVFNGRFSPETYLELLQKYQINVLCCTPTEYRMMAKLQNLNDYDLTHLHSAV
SAGEPLNREVVEQFKKYFNLTVRDGYGQTESTLLIGFLKDTPQRIGSMGKGIPGSSVTVV
DDEGNSVPANTEGNIAVPLDLPALFKGYYKEPERTAKAQTGKYYITGDLAHVDDDGYFWF
EGRRDDIIISSGYTIGPFEVEDALTNHPAVKECAVVAKPHDIRGNIVKAFVILQDHTAGD
DTLVKELQQFVKNEVAPYKYPREIEFVDDLPKTNSGKIRRVELRDAEIEKWQQQKDSNQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaaggaagttagttatgcaaaagtcagctctattcgcgcctgaaaaatataac
attatttcggaaatcgaaaaatatagccacataccagataaaaaggcaattttatatcat
aatactgaaggcgaagatatatcagtcacttaccaacagctcattgaacagtctaataaa
gtaggcaatgttttagcatcgcacggtttatctaaaggtgataaagtactcattatgatg
ccacgatctattgcgacgtatgaattatatattgctgctttaaaattaggtgtcgcaatc
attccatgttctgaaatgctaagaactaaagatttacaataccgtatcacacatggtgaa
attaatgcagttattgcactagagccattcacagttgaatttgaaaaaattaaaggatat
gatgcgttaactaaatttgttattgccggtcaaaaagatggatggatttcacttgaagct
gaaaaagaaaacgcaagtaacaaactagaaatggcagatacgacgcgagatgatacagcg
attttgtcatatacatctggtacaactggcaatcctaaagccgttacacattgtcatgga
tggggatttgcacatttacaaatggcaccaaaacattggttatgtattaatgaagatgac
ttagtttgggcaacagcagcaccaggttggcaaaaatgggtatggagtcctttcttatct
gtattaggttcaggtgcaactgcttttgtatttaatggaagattcagtcctgaaacatac
ttagaattgcttcaaaaatatcaaattaatgttttatgttgtacaccgacagaatatcgt
atgatggctaaattacagaacttaaatgattatgacttaacgcatttacatagtgccgtt
tctgcaggtgagccactaaatcgagaagtagttgaacaattcaagaaatactttaattta
actgtaagagatggatatggccagactgaaagtaccttgcttataggctttttaaaagat
acaccacaaaggattggatcaatgggtaaaggcattccgggtagttcggtcactgtagta
gatgatgaggggaatagcgtacctgctaatacggaagggaatattgcagtaccacttgat
ttgccagcacttttcaaaggatattataaggagccagaacgtacggcgaaagcgcaaaca
ggtaaatactacatcactggtgacttagctcatgtagatgatgatggttatttctggttt
gaaggacgtcgagatgacattattattagttcaggctatacgattgggccttttgaagtt
gaagatgcgttaacgaatcatccagccgttaaagaatgtgctgtagtagcaaaacctcat
gatatacgaggcaatattgtgaaagcattcgttattttacaagaccatactgcgggtgat
gatacgttagttaaagaactacaacaatttgttaaaaatgaagttgcaccatataaatat
ccgagagagattgaattcgttgacgacttaccaaaaacaaactcaggtaaaattcgtcgt
gttgaactacgagatgctgaaatagaaaaatggcaacaacaaaaagatagcaatcaataa

DBGET integrated database retrieval system