KEGG   Staphylococcus aureus subsp. aureus HO 5096 0412: SAEMRSA15_25840Help
Entry
SAEMRSA15_25840   CDS       T02059                                 

Gene name
hisD
Definition
putative histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sux  Staphylococcus aureus subsp. aureus HO 5096 0412
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sux01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sux00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2800668..2801924)
Genome map
AA seq 418 aa AA seqDB search
MPMLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEIS
HEQIKAAFDTLDEKTKQALQQSYERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYV
PGGKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVLAACYITQVNQVFQVGGAQ
SIAALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDDTTDLDA
IVYDVFAQAEHDELARTYVISEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHA
SNFDEACHVMNTIAPEHASIQTVNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLP
TNRTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAHVEALYNHQQSILIRQS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttgccaatgcttaatgcacaacaatttttaaatcaattttcattagaagcaccattagat
gagtcattgtatccaattattcgcgatatttgtcaggaagttaaagttcatggagataag
gctttgaaaatgtataatctaacattcgatcatacgaaaacagatcatttagaaattagt
catgaacaaattaaagcagcatttgacacattagatgaaaaaacaaaacaagcattacaa
caaagttatgaaagaattaaagcatatcaagaaagtattaaacagacgaatcaacagtta
gaagaatcagtggagtgttatgaaatataccatccactagaaagtgtgggtatttatgtg
cctggtggcaaagcaagttatccatcaacggttctaatgacagcgactttagcacaagta
gcaggtgtagaaaatattgttgttgtgacaccacctcaacctaacggagtatcccaagag
gtattagctgcatgttatattacgcaagttaatcaagtgtttcaagttggtggtgctcaa
agtattgctgcattgacttatggaacagaaacgatacctaaagttgataagattgtaggt
ccaggtaaccaatttgttgcatatgccaaaaaatatttatttggacaggtaggtattgat
caaattgcaggaccaacagaaatagcactgattattgacgacaccacagatttagatgcc
atcgtatatgatgtatttgcgcaagcagaacatgatgaattagcacgtacatatgtcatt
agtgaagatgcgcaagtccttaaagatttagaatcacgtattgctaaagcattgcctaat
gtggacagatacgacattgtttctaaaagtatcgctaatcaacactaccttatccatgct
agtaattttgatgaagcatgccatgtcatgaatacaatcgcgcctgaacatgcgtcgatt
caaacagtaaatcctcaaccatatattgaaaaagtgaaatatgtgggtgcattgtttatt
ggacattattcgccagaggtcataggagattacgttgcaggtccaagtcatgtattacct
acaaatagaacagctagatttaccaatgggttatcggtcaatgatttcttaacacggaac
acggtcatccatttatcaaaagatacgtttgaacaaattgctgattcagcacaacatatt
gctcatgttgaagcattatacaatcaccagcagtctattttaatacgtcagtcttag

DBGET integrated database retrieval system