KEGG   Staphylococcus aureus 04-02981: SA2981_0375Help
Entry
SA2981_0375       CDS       T02070                                 

Definition
truncated phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SA2981_0375
   01230 Biosynthesis of amino acids
    SA2981_0375
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA2981_0375
  Energy metabolism
   00680 Methane metabolism
    SA2981_0375
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SA2981_0375
Enzymes [BR:suy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SA2981_0375
Exosome [BR:suy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SA2981_0375
  Exosomal proteins of melanoma cells
   SA2981_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
417741..418346
Genome map
AA seq 201 aa AA seqDB search
MHKVRSNIMTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQI
KHVYVSDLLRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDP
NFKDFRHSFSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFN
KVSREEAVDLKVENCKPYIIE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atacataaggtaaggagtaatattatgacgatttatttagttagacatggcgaatcaaaa
tcgaattatgataataaacattttcgatcttatttttgtggacaattagatgtgccgtta
acggatactggcacaaaaagtgcagacgatttatgtgattattttaaagagaaacagatt
aaacatgtatatgtttcagacttattaagaacacagcaaacgtttgaacatatttttcca
tatgacattgcatcaacgactacccctctattaagagaacgttcacttggcgtatttgag
ggtgaatataaagatgaaatcagtgcgaatccgaaatatgaaaaatatttcaatgatcca
aactttaaagactttcgtcatagtttttcacaaaaagcgcctgaaggagaaagttatgaa
gatgtatatcaacgcgtagaacattttatgaatcatgttgtcaatgaagatacacaaaaa
gatgatattgtcattgttgcacatcaagttgtcattcgttgtttgatggtttattttaac
aaagtttcaagggaagaagctgtggatttaaaggtagaaaattgcaaaccatatatcatt
gaatag

DBGET integrated database retrieval system