KEGG   Staphylococcus aureus 04-02981: SA2981_0533Help
Entry
SA2981_0533       CDS       T02070                                 

Definition
Deoxyadenosine kinase / Deoxyguanosine kinase (EC:2.7.1.76 2.7.1.113)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SA2981_0533
   00240 Pyrimidine metabolism
    SA2981_0533
Enzymes [BR:suy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     SA2981_0533
    2.7.1.76  2'-deoxyadenosine kinase
     SA2981_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(598978..599649)
Genome map
AA seq 223 aa AA seqDB search
MLPMNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFER
WSFHLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSD
LFNAMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINS
FNACPVVRININEYDIHKDPESLNPMIDKIARIIQTYRQVDTR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atattaccaatgaataattacggtattccacaaaatgccattataaccattgcaggtaca
gttggtgttggaaaatcaacactaacgcaagcacttgcagataaattaaactttaaaacg
tcttttgaaaatgtcgaacataatccatatttagataaattttatagcgattttgaacga
tggagtttccatttgcaaatttacttcttagctgaacgttttaaagaacaaaagcgtatg
tttgaatatggtggtggctttgtccaagatcgatcaatttatgaagatgttgatattttt
gcaaaaatgcatgaagaagaaggcacaatgagtaaagaagatttcaaaacatattcagac
ttatttaatgccatggtcatgacaccttattttcctaaaccagatgtaatgatttattta
gaatgtaactatgatgaggtcattgatcgtattattgaacgtggtcgcgaaatggaaatt
aatacagaccctgaatactggaaaaagctatttaaacgctatgacgattggattaatagc
tttaatgcatgtccagttgtacgtatcaatattaatgaatatgatatccataaggacccc
gaatctttaaatcctatgatagacaaaattgctcgaattattcaaacatatcgacaagta
gatacacgataa

DBGET integrated database retrieval system