KEGG   Staphylococcus aureus 04-02981: SA2981_0752Help
Entry
SA2981_0752       CDS       T02070                                 

Gene name
tpi
Definition
(RefSeq) Triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SA2981_0752 (tpi)
   01230 Biosynthesis of amino acids
    SA2981_0752 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA2981_0752 (tpi)
   00051 Fructose and mannose metabolism
    SA2981_0752 (tpi)
   00562 Inositol phosphate metabolism
    SA2981_0752 (tpi)
Enzymes [BR:suy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SA2981_0752 (tpi)
Exosome [BR:suy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SA2981_0752 (tpi)
  Exosomal proteins of bladder cancer cells
   SA2981_0752 (tpi)
  Exosomal proteins of melanoma cells
   SA2981_0752 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
832616..833377
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKSVVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagctggtaactggaaaatgaacaaaacagtacaagaagcaaaa
gacttcgtcaatgcattaccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcgttcacaggtgaaacg
tctccagttgcattagcagatttaggcgttaaatacgttgttatcggtcattctgaacgt
cgtgaattattccacgaaacagatgaagaaattaacaaaaaagcgcacgctattttcaaa
catggaatgactccaattatttgtgttggtgaaacagacgaagagcgtgaaagtggtaaa
gctaacgatgttgtaggtgagcaagttaagaaagctgttgcaggcttatctgaagatcaa
cttaaatcagttgtaattgcttatgagccaatctgggcaatcggaactggtaaatcatca
acatctgaagatgcaaatgaaatgtgtgcatttgtacgtcaaactattgctgacttatca
agcaaagaagtatcagaagcaactcgtattcaatatggtggtagtgttaaacctaacaac
attaaagaatacatggcacaaactgatattgatggggcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system