KEGG   Staphylococcus aureus 04-02981: SA2981_1203Help
Entry
SA2981_1203       CDS       T02070                                 

Gene name
sucC
Definition
Succinyl-CoA ligase [ADP-forming] beta chain (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:suy01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:suy00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:suy00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:suy00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1265848..1267014
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
KIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQ
VTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKF
LLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHKDVVELRDLEEEDP
KEIEASKHDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDAGGSATREKVTE
AFKIILGDENVKGIFVNIFGGIMKCDVIAEGIVEAVKEVDLTLPLVVRLEGTNVELGKKI
LKDSGLAIEPAATMAEGAQKIVKLVKEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcaaggtaaagaaatatttcgttcaatgggcgttgcagttcca
gaaggacgagtagcatttactgctgaagaagcggtggagaaagcaaaagaattaaattct
gatgtatatgttgtaaaagcacaaattcatgctggaggtagaggtaaagcaggcggagta
aaaattgctaaatctttatctgaggtagaaacatatgcaaaagaattattagggaaaact
ttggtgacacatcaaactggtccagaaggtaaagaaattaaacgtttatatatcgaagaa
ggttgtgctattcaaaaagaatattacgttggattcgttattgatcgtgcgactgaccaa
gtaacattgatggcgtctgaagaagggggcactgagattgaagaagttgctgcgaagact
cctgaaaagatcttcaaagaaactatcgatccagtaatcggactttcaccattccaagca
agacgaattgcgtttaatattaatattcctaaagaatctgttaacaaagctgctaaattc
ttattagcactttataatgtattcattgaaaaagattgttcaatcgtagaaatcaaccca
ttagttacaacagctgatggtgatgtattggcattagatgctaaaattaattttgatgat
aatgcattattcagacataaagatgttgtagaattacgtgatttagaagaagaagatccg
aaagagattgaagcgtctaaacatgatttatcatacattgcattagatggtgacatcgga
tgtatggttaatggtgcaggtttagccatggcaacaatggatacgattaatcatttcggt
ggaaacccagccaatttcttagatgcaggcggaagcgctactagagaaaaagtaactgaa
gcatttaaaatcattttaggtgatgaaaatgttaaaggtatttttgtaaacattttcggt
ggcattatgaaatgtgatgttatcgcagaaggtatcgttgaagctgtaaaagaagtagat
ttaactttaccactagttgtacgcttagaaggtacaaatgttgagttaggtaaaaaaatc
ttaaaagactcaggattagcaattgaaccagcagcaacaatggctgaaggtgcacaaaaa
attgttaaactagtcaaagaagcataa

DBGET integrated database retrieval system