KEGG   Staphylococcus aureus 04-02981: SA2981_1366Help
Entry
SA2981_1366       CDS       T02070                                 

Gene name
odhB
Definition
Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:suy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SA2981_1366 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SA2981_1366 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    SA2981_1366 (odhB)
Enzymes [BR:suy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SA2981_1366 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1452485..1453753)
Genome map
AA seq 422 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
SEGDTVEVGQAIAIIGEGSGNASKENSNDNTPQQNEETNNKKEETTNNSVDKAEVNQAND
DNQQRINATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKEE
KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM
KDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPFV
RDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAA
ILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccagaattagcagaatctattacagaaggtaccattgcagaa
tggttgaaaaacgtaggggatagcgtagaaaaaggtgaagctattcttgaattagaaact
gataaagttaatgtcgaagttgtatctgaagaagcaggtgtattatctgaacaacttgca
agtgaaggcgacactgtagaagttggacaagcaattgctatcatcggcgaaggtagtggc
aatgcttctaaagaaaatagtaacgacaatactccacaacaaaatgaagaaacaaataat
aaaaaagaagaaacaacaaataattcggtagataaagctgaagtcaatcaagcaaatgat
gacaatcagcaacgtattaatgctacgccttctgcgcgtcgatatgctcgtgaaaatggt
gtgaatcttgctgaagtaagtccgaaaacaaatgatgtggttcgtaaagaagatattgat
aagaaacaacaggcaccggcatcaacacaaacaacacaacaagcacctgcaaaagaagag
aaaaaatacaatcaatatcctacaaaaccagtgattcgtgaaaaaatgtcacgcagaaag
aaaacagctgccaaaaaattattagaggtatctaataatacagctatgttaacaacattt
aacgaagttgacatgacaaatgttatggaattgcgtaaacgtaagaaagaacaatttatg
aaagatcatgatggtactaaattaggatttatgtcattctttactaaagcttctgtagca
gctttgaaaaagtatccagaagttaatgcagaaatcgatggcgacgacatgattacgaaa
caatattatgatattggtgtagctgtttctacagatgatggattattagtaccatttgta
agagattgtgataaaaagaattttgcagaaatcgaagcagaaattgctaatttagcagtt
aaagcacgagagaaaaaacttggcttagatgatatggttaatggttcatttacgattaca
aatggcggtatttttggatcaatgatgagtacgccaattatcaatggtaatcaagctgca
atcttaggcatgcattcaattattacaagaccaattgcgattgatcaagatacaatcgaa
aatcgtccaatgatgtatattgcattaagctatgatcatagaattattgacggtaaagaa
gcagttggattcttaaaaacaattaaagaattaattgaaaacccagaagacttattatta
gaatcttaa

DBGET integrated database retrieval system