KEGG   Staphylococcus aureus 04-02981: SA2981_1380Help
Entry
SA2981_1380       CDS       T02070                                 

Gene name
dfrA
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:suy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SA2981_1380 (dfrA)
   00670 One carbon pool by folate
    SA2981_1380 (dfrA)
Enzymes [BR:suy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SA2981_1380 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1466579..1467058)
Genome map
AA seq 159 aa AA seqDB search
MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactttatccattctagttgcacatgacttgcaacgagtaattggttttgaaaatcaa
ttaccttggcacctaccaaatgatttgaaacatgttaaaaaattatcaacaggtcatact
ttagtaatgggtcgtaagacatttgaatcgattggtaaaccactaccgaatcgtcgaaat
gttgtacttacttcagatacaagtttcaacgtagagggcgttgatgtaattcactctatt
gaagatatttaccaactaccgggccatgttttcatatttggagggcaaacattatttgaa
gaaatgattgataaagtggacgacatgtatattactgttattgaaggtaaattccgtggt
gatacgttctttccaccttatacatttgaagactgggaagttgcctcttcagttgaaggt
aaactagatgagaaaaatacaattccacatacctttctacatttaattcgtaaaaaataa

DBGET integrated database retrieval system