KEGG   Staphylococcus aureus 04-02981: SA2981_1577Help
Entry
SA2981_1577       CDS       T02070                                 

Definition
(GenBank) Exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
suy03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SA2981_1577
Enzymes [BR:suy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SA2981_1577
DNA repair and recombination proteins [BR:suy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SA2981_1577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 T2SSE AAA AAA_12 AAA_18 AAA_14 AAA_29 Mg_chelatase NTPase_1 TsaE Helicase_RecD ABC_tran HHH_3 UvrD_C 5_3_exonuc AAA_28 RsgA_GTPase AAA_22 Zeta_toxin AAA_16 DUF815 NACHT
Motif
Other DBs
NCBI-ProteinID: ADC37788
Position
complement(1684038..1686515)
Genome map
AA seq 825 aa AA seqDB search
MSDPTLFDYSMIKGTVEAILFQNSDNFYTVLKVDTIETNEDFDTMPTVVGFLPNIVEGDV
YTFKGQVVDHPRYGKQLKAETFEKEMPQTKEAIISYLSSDLFKGVGKKTAQNIVNTLGDN
AINDILDDHSVLEKVSGLSKKKQKQIAEQISANQESEKIMIRLHDLGFGPKLSMAIYQFY
LGDTLTILDRNPYQLIYDIKGIGFNKADQLARNIGIAYNDNERLKAALLYTLEEECIKQG
HTYLPINVVIDLTVDVLNYQDEEVIEPEKLDEMLQYLNEEKRLIIDNEQVAIPSLYYSEI
KSVQNLFRIKTHTNKLTEIEQSDLQMHIGEIEDANQVNYAASQKEALQTAINSKVMLLTG
GPGTGKTTVIKGIVELYAEIHGLSLDYDDYVNDDYPVVLAAPTGRASKRLQESTGLEAMT
IHRLIGWNQDTKPEDILENEINARLIIIDEMSMVDTWLFHQFLSAVPLDAQLIFVGDEDQ
LPSVGPGQVFKDLIESKAIPRVNLTEVYRQQDGSSIIELAHRMKLGQKIDITQRFHDRSF
INCQANQIPTVVEKVVTSAVNKGYTMADIQVLAPMYKGNAGIKRLNQVLQDILNPKKKDT
REIEFGDVVFRKGDKVLQLVNRPNDNIFNGDIGVIVGIFWAKENALNKDVLVVDFEGNEI
TFTKQDMMELTHAYCTSIHKSQGSEFPIVIMPIVKQYFRMLQRPILYTGLTRAKTSLVLL
GDPEAFDIGLKTNGQARLTQLCTLLKNYFNSEDEEMLENTATNDTGASQTTIDDQVEAPM
SSNDSGEVTSDSTKTDINVLTEATMFKIDPMINMGEITPYDFIER
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaccctacactatttgattattcaatgatcaaaggtactgttgaagcgatattg
tttcaaaacagtgataatttttatacagtgcttaaagtagatactattgaaacaaatgaa
gactttgatacaatgccaactgttgtagggtttcttccgaatattgttgaaggcgatgtc
tacacatttaaagggcaagttgttgatcatccacgttatggtaaacaattaaaagcagag
acttttgaaaaagaaatgccacaaacgaaagaagcaattataagttatttatctagtgat
ttgtttaaaggtgtaggtaaaaagacagctcaaaatattgttaatacattaggtgacaat
gcgataaatgatatattagatgaccattcagtgctagaaaaagtttcgggattatctaaa
aagaaacagaaacaaattgcagaacaaatttcagcaaatcaagaatctgaaaaaataatg
attcgtttacatgatttagggtttggtcctaaactttcaatggcaatttatcagttttat
ctcggcgatacactgactattttagatcgaaatccatatcaattgatttatgatattaaa
ggtattggttttaataaagcagatcaacttgctagaaatattggtatcgcttataacgat
aatgaacgattaaaagctgcgttgctctatacgttagaagaagaatgtattaaacaggga
catacatatttgcctatcaatgttgttatagatttaacggttgatgtattaaattatcaa
gatgaagaggtcatcgaacctgaaaaattagacgaaatgttgcaatacttaaatgaggaa
aaacgactaattattgacaatgaacaagttgcaattccaagtttgtattattctgaaatc
aaaagtgttcaaaacttattcagaataaagacgcatacaaataaacttacggaaattgaa
cagtcagatttacaaatgcatattggtgaaatagaagatgcgaatcaagtgaactatgca
gcttcacaaaaagaagctttgcaaacggctatcaattctaaggtgatgctattaaccggt
ggaccgggaacaggaaagacgacagtaattaaaggtattgtagaattatatgctgagatt
catggcttatcattagattatgatgattatgtcaatgatgattatccagttgtattagca
gcgccaacaggaagagcgtctaagagactacaagagtcaactggattagaagcaatgacg
attcatcgtttaataggttggaatcaagacacaaagccagaggatatattagaaaatgaa
ataaacgcacgactcataatcattgatgagatgtctatggtagatacttggttgtttcac
caatttttaagtgcagttcctttagatgcacaattgatatttgtaggtgatgaggaccaa
ttgccttctgtaggtcctggtcaagtatttaaagatttaattgaatcgaaagctatacca
cgagttaatctgactgaagtatatcgtcaacaagatggttcaagcattatagaattagca
catcgaatgaaattgggtcagaaaattgatattacacagcgttttcatgatagaagtttt
attaactgtcaggcaaaccaaataccaacagttgttgagaaggtagttactagtgctgtt
aataaagggtatactatggctgatattcaagtgcttgcaccaatgtataaaggaaatgcc
ggtattaaacgtttaaatcaagttttacaagatattttaaaccctaaaaagaaagacaca
cgagaaattgagtttggtgatgtagtctttagaaaaggtgacaaagtattacaacttgtt
aataggccaaatgataacatattcaatggtgacataggagttattgttggtattttttgg
gcgaaagaaaatgcccttaataaagatgtacttgttgtggattttgaaggtaatgaaatt
acatttacgaaacaagatatgatggaattaacacatgcttattgtacatcaatccataaa
tcacaaggttcagaatttcctattgttatcatgcctattgttaaacagtattttagaatg
ttacaaagaccgatattatatactggtttaactagagcgaaaacgagtttagttctactt
ggtgatccagaagcatttgatattggattaaaaacaaatggtcaagcgcgtttaacacaa
ttatgtacattgttgaaaaattattttaattcagaagatgaagaaatgctggaaaacaca
gcaactaatgatacaggagcttcacaaacgacaatagatgatcaagtagaagcgccaatg
tcatcgaatgatagtggagaagttacgtctgattcaacaaaaacagatataaatgtatta
acggaagctacaatgtttaaaattgacccaatgattaatatgggagaaatcacgccgtat
gactttatagaacgttga

DBGET integrated database retrieval system