KEGG   Staphylococcus aureus 04-02981: SA2981_1657Help
Entry
SA2981_1657       CDS       T02070                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
suy00010  Glycolysis / Gluconeogenesis
suy00030  Pentose phosphate pathway
suy00051  Fructose and mannose metabolism
suy00052  Galactose metabolism
suy00680  Methane metabolism
suy01100  Metabolic pathways
suy01110  Biosynthesis of secondary metabolites
suy01120  Microbial metabolism in diverse environments
suy01130  Biosynthesis of antibiotics
suy01200  Carbon metabolism
suy01230  Biosynthesis of amino acids
suy03018  RNA degradation
Module
suy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suy_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:suy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA2981_1657 (pfk)
   00030 Pentose phosphate pathway
    SA2981_1657 (pfk)
   00051 Fructose and mannose metabolism
    SA2981_1657 (pfk)
   00052 Galactose metabolism
    SA2981_1657 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SA2981_1657 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SA2981_1657 (pfk)
Enzymes [BR:suy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SA2981_1657 (pfk)
Protein phosphatases and associated proteins [BR:suy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SA2981_1657 (pfk)
Messenger RNA biogenesis [BR:suy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SA2981_1657 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADC37868
Position
complement(1770587..1771510)
Genome map
AA seq 307 aa AA seqDB search
MNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYSARCPE
FKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQTIGIPGTIDNDINGT
DFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPE
VKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQDCQKELSQYINVDNRVSVLGHVQRG
GSPTGADRVLASRLGGYAVDLLMQGETAKGVGIKNNKIVATSFDEIFDGKDHKFDYSLYE
LANKLSI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgccgtaagagcagttgttcgtacagcaatttacaatgaaattgaagtttat
ggtgtgtatcatggttaccaaggattgttaaatgatgatattcataaacttgaattagga
tcagttggggatacgattcagcgtggaggtacattcttgtattcagcaagatgtccagag
tttaaggagcaagaagtacgtaaagttgcaatcgaaaacttacgtaaaagagggattgag
ggccttgtagttattggtggtgacggtagttatcgcggtgcacaacgcatcagtgaggaa
tgcaaagaaattcaaactatcggtattcctggtacgattgacaatgatatcaatggtact
gattttacaattggatttgacacagctttaaatacgattattggcttagtcgacaaaatt
agagatactgcgtcaagtcacgcacgaacatttatcattgaagcaatgggccgtgattgt
ggagatctagcattatgggctggattatcagttggtgctgagacaattgtagttccagaa
gtgaaaacagatattaaagaaatagctgataaaattgaacaaggtattaaacgtggtaag
aaacactcaatcgttcttgtagcagaaggttgcatgactgcgcaagattgtcaaaaagaa
ttatcacaatacatcaatgttgataatagagtgtctgtgttaggtcacgttcaacgtggt
ggtagcccaacaggtgcggatagagttttagcatcacgtttaggtggatatgcggtagac
ttattaatgcaaggtgaaacagctaagggtgttggaattaagaacaataaaattgtagca
acatcttttgatgaaatttttgatggtaaagatcataaatttgattatagtctatatgaa
cttgctaacaagttatctatataa

DBGET integrated database retrieval system