KEGG   Staphylococcus aureus 04-02981: SA2981_1657Help
Entry
SA2981_1657       CDS       T02070                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:suy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SA2981_1657 (pfk)
   01230 Biosynthesis of amino acids
    SA2981_1657 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA2981_1657 (pfk)
   00030 Pentose phosphate pathway
    SA2981_1657 (pfk)
   00051 Fructose and mannose metabolism
    SA2981_1657 (pfk)
   00052 Galactose metabolism
    SA2981_1657 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SA2981_1657 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SA2981_1657 (pfk)
Enzymes [BR:suy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SA2981_1657 (pfk)
Protein phosphatases and associated proteins [BR:suy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SA2981_1657 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1770587..1771510)
Genome map
AA seq 307 aa AA seqDB search
MNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYSARCPE
FKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQTIGIPGTIDNDINGT
DFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPE
VKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQDCQKELSQYINVDNRVSVLGHVQRG
GSPTGADRVLASRLGGYAVDLLMQGETAKGVGIKNNKIVATSFDEIFDGKDHKFDYSLYE
LANKLSI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgccgtaagagcagttgttcgtacagcaatttacaatgaaattgaagtttat
ggtgtgtatcatggttaccaaggattgttaaatgatgatattcataaacttgaattagga
tcagttggggatacgattcagcgtggaggtacattcttgtattcagcaagatgtccagag
tttaaggagcaagaagtacgtaaagttgcaatcgaaaacttacgtaaaagagggattgag
ggccttgtagttattggtggtgacggtagttatcgcggtgcacaacgcatcagtgaggaa
tgcaaagaaattcaaactatcggtattcctggtacgattgacaatgatatcaatggtact
gattttacaattggatttgacacagctttaaatacgattattggcttagtcgacaaaatt
agagatactgcgtcaagtcacgcacgaacatttatcattgaagcaatgggccgtgattgt
ggagatctagcattatgggctggattatcagttggtgctgagacaattgtagttccagaa
gtgaaaacagatattaaagaaatagctgataaaattgaacaaggtattaaacgtggtaag
aaacactcaatcgttcttgtagcagaaggttgcatgactgcgcaagattgtcaaaaagaa
ttatcacaatacatcaatgttgataatagagtgtctgtgttaggtcacgttcaacgtggt
ggtagcccaacaggtgcggatagagttttagcatcacgtttaggtggatatgcggtagac
ttattaatgcaaggtgaaacagctaagggtgttggaattaagaacaataaaattgtagca
acatcttttgatgaaatttttgatggtaaagatcataaatttgattatagtctatatgaa
cttgctaacaagttatctatataa

DBGET integrated database retrieval system