KEGG   Staphylococcus aureus 04-02981: SA2981_2436Help
Entry
SA2981_2436       CDS       T02070                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:suy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SA2981_2436 (gtaB)
   00052 Galactose metabolism
    SA2981_2436 (gtaB)
   00500 Starch and sucrose metabolism
    SA2981_2436 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    SA2981_2436 (gtaB)
Enzymes [BR:suy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SA2981_2436 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2579231..2580097)
Genome map
AA seq 288 aa AA seqDB search
MKKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRH
KRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQF
IGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNG
RQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNND
NQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKALGL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataaaaaaggcaatcattcccgctgctggtttagggactagatttttacca
gcaactaaagcgatgccaaaggaaatgcttcctatcttagataaacccacaatacaatat
atcgttgaagaagctgcaagagctggaattgaagatattattatagtgacaggtcgccac
aaacgcgcgattgaagatcattttgatagtcaaaaagaattagaaatggtgttaaaagaa
aaaggtaaatctgaattactagaaaaagttcaatactcgacagaacttgcgaatattttt
tatgtaagacagaaagaacaaaaaggtttagggcatgcgattagttctgcgcgtcaattt
atcggcaatgaaccatttgcggtattattaggtgacgatattgttgaatctgaagtgcca
gcagtgaaacagttgattgacgtttatgaagaaacggggcactcagttataggtgtccaa
gaagttccggaagcagatactcatcgttatggaattattgatccattaactaaaaatgga
cgtcagtatgaagtgaaaaagtttgttgaaaagccagcacaaggtacggcaccatcaaac
ctagctattatgggccgatatgtattaacgcctgaaattttcgattatttaaaaacgcaa
aaagaaggcgcaggtaacgaaattcagttaacagatgcgattgagcgtatgaacaatgat
aatcaagtgtatgcatatgacttcgaaggcgaacgttatgacgttggagaaaaattagga
tttgtcaaaacaacaatagaatatgcgttgaaagatgacagtatgcgagaagaattaaca
cgatttattaaagcattaggtttataa

DBGET integrated database retrieval system