KEGG   Staphylococcus aureus 04-02981: SA2981_2618Help
Entry
SA2981_2618       CDS       T02070                                 

Definition
Histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
suy  Staphylococcus aureus 04-02981
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:suy01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:suy00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2788250..2789506)
Genome map
AA seq 418 aa AA seqDB search
MPMLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEIS
HEQIKAAFDTLDEKTKQALQQSYERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYV
PGGKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVLAACYITQVNQVFQVGGAQ
SIAALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDDTADLDA
IVYDVFAQAEHDELARTYVIGEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHA
SNFDEACHVMNTIAPEHASIQTVNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLP
TNRTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAHVEALYNHQQSILIRQS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttgccaatgcttaatgcacaacaatttttaaatcaattttcattagaagcaccattagat
gagtcattgtatccaattattcgcgatatttgtcaggaagttaaagttcatggagataag
gctttgaaaatgtataatctaacattcgatcatacgaaaacagatcatttagaaattagt
catgaacaaattaaagcagcatttgacacattagatgaaaaaacaaaacaagcattacaa
caaagttatgaaagaattaaagcatatcaagaaagtattaagcagacgaatcaacagtta
gaagaatcagtggagtgttatgaaatataccatccactagaaagtgtgggtatttatgtg
cctggtggcaaagcaagttatccatcaacggttctaatgacagcgactttagcacaagta
gcgggtgtagaaaatattgttgttgtgacaccacctcaacctaacggagtatcccaagag
gtattagctgcatgttatattacgcaagttaatcaagtgtttcaagttggtggtgctcaa
agtattgctgcattgacttatggaacagaaacgatacctaaagttgataagattgtaggt
ccaggtaaccaatttgttgcatatgccaaaaaatatttatttggacaggtaggtattgat
caaattgcaggaccaacagaaatagcactgattattgacgacaccgcagatttagatgcc
atcgtatatgatgtatttgcgcaagcagaacatgatgaattagcacgtacatatgtcatt
ggtgaagatgcgcaagtccttaaagatttagaatcacgtattgctaaagcattgcctaat
gtggacagatacgacattgtttctaaaagtatcgctaatcaacactaccttatccatgct
agtaattttgatgaagcatgccatgtcatgaatacaatcgcgcctgaacatgcgtcgatt
caaacagtaaatcctcaaccatatattgaaaaagtgaaatatgtgggtgcattgtttatt
ggacattattcgccagaggtcataggagattacgttgcaggtccaagtcatgtattacct
acaaatagaacagctagatttaccaatgggttatcggtcaatgatttcttaacacggaac
acggtcatccatttatcaaaagatacgtttgaacaaattgctgattcagcacaacatatt
gctcatgttgaagcattatacaatcaccagcagtctattttaatacgtcagtcttag

DBGET integrated database retrieval system