KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_1203Help
Entry
MS7_1203          CDS       T01950                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
suz00020  Citrate cycle (TCA cycle)
suz00640  Propanoate metabolism
suz00660  C5-Branched dibasic acid metabolism
suz01100  Metabolic pathways
suz01110  Biosynthesis of secondary metabolites
suz01120  Microbial metabolism in diverse environments
suz01130  Biosynthesis of antibiotics
suz01200  Carbon metabolism
Module
suz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:suz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MS7_1203 (sucC)
   00640 Propanoate metabolism
    MS7_1203 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MS7_1203 (sucC)
Enzymes [BR:suz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MS7_1203 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEW65212
Position
1263588..1264754
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
KIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQ
VTLMASEEGGTEIEEVASKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKF
LLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHKDVVELRDLEEEDP
KEIEASKHDLSYIALDGGIGCMVNGAGLAMATMDTINHFGGNPANFLDAGGSATREKVTE
AFKIILGDENVKGIFVNIFGGIMKCDVIAEGIVEAVKEVDLTLPLVVRLEGTNVELGKKI
LKDSGLAIEPAATMAEGAQKIVKLVKEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcaaggtaaagaaatatttcgttcaatgggcgttgcagttcca
gaaggacgagtagcatttactgctgaagaagcggtggagaaagcaaaagaattaaattct
gatgtttatgttgtaaaagcacaaattcatgctggaggtagaggtaaagcaggcggagta
aaaattgctaaatctttatctgaggtagaaacatatgcaaaagaattattagggaaaact
ttggtgacacatcaaactggtccagaaggtaaagaaattaagcgtttatatatcgaagaa
ggttgtgctattcaaaaagaatattacgttggattcgttattgatcgtgcgactgaccaa
gtaacattgatggcgtctgaagaagggggcactgagattgaagaagttgcttcgaagact
cctgaaaagatcttcaaagaaactatcgatccagtaatcggactttcaccattccaagca
agacgaattgcgtttaatattaatattcctaaagaatctgttaacaaagctgctaaattc
ttattagcactttataatgtattcattgaaaaagattgttcaatcgtagaaatcaaccca
ttagttacaacagctgatggtgatgtattggcattagatgctaaaattaattttgatgat
aatgcattattcagacataaagatgttgtagaattacgtgatttagaagaagaagatccg
aaagagattgaagcgtctaaacatgatttatcatacattgcattagatggtggcatcgga
tgtatggttaatggtgcaggtttagccatggcaacaatggatacgattaatcatttcggt
ggaaacccagccaatttcttagatgcaggcggaagcgctactagagaaaaagtaactgaa
gcatttaaaatcattttaggtgatgaaaatgttaaaggtatttttgtaaatattttcggt
ggcattatgaaatgtgatgttatcgcagaaggtatcgttgaagctgtaaaagaagtagat
ttaactttaccactagttgtacgcttagaaggtacaaatgttgagttaggtaaaaaaatc
ttaaaagactcaggattagcaattgaaccagcagcaacaatggctgaaggtgcacaaaaa
attgttaaactagtcaaagaagcataa

DBGET integrated database retrieval system