KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_1257Help
Entry
MS7_1257          CDS       T01950                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:suz00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1329958..1331454
Genome map
AA seq 498 aa AA seqDB search
MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMT
EVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYE
QTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKAAHIT
DYSNASRTLMFNIHDLEWDDELLELLTVPKNMLPEVKPSSEVYGKTIDYHFYGQEVPIAG
VAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGIDGKVNYA
LEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEAR
GAIFGLSRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQF
QADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREK
LYRGWKKAVEATQVFKTE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatattttatctatagaccaaggaacaacaagctcaagagcgattttattc
aatcaaaaaggggaaattgcaggggtagcacaacgtgagtttaagcaatattttccacaa
tcaggttgggttgaacatgatgcaaatgaaatttggacatctgtgttagctgtaatgacg
gaagtaattaatgaaaatgatgttagagctgatcaaattgcaggtatcggtattacaaac
caacgcgaaacaacggtggtttgggacaaacatactggccgcccaatttatcacgcaatt
gtttggcaatcacgtcaaacacaatcaatttgttcagaattaaaacaacaaggatatgaa
caaacatttagagataagacaggattacttttagatccgtattttgcaggtacaaaagtt
aaatggattctagacaatgttgaaggtgcacgagaaaaagcagaaaatggcgatctatta
tttggaacgattgatacttggttagtatggaaattatcaggaaaagctgcgcatattact
gattattcaaatgcgagtcgtacattaatgtttaatatccatgatttagaatgggacgat
gagttattagaactacttacagtacctaaaaatatgttgccagaagttaaaccttcaagt
gaagtatatggtaagacaattgattaccacttctatggtcaagaagtaccaatcgctggt
gtagctggtgatcaacaagcagcattatttggacaagcttgcttcgaacgtggtgacgtg
aaaaacacatatggaactggtggcttcatgttaatgaatacaggtgacaaagcggttaaa
tctgaaagtggtttattaacaacaattgcttatggtattgatggaaaagtaaattatgcg
cttgaaggttccatctttgtttcgggttcagcaatccaatggttacgtgatggattaaga
atgattaattcagcaccacaatcagaaagttatgcgacacgagttgactctactgagggt
gtttatgttgttccagcttttgtaggtttaggaacaccatattgggattctgaagcacgt
ggtgcgattttcggtttatcacgtggaactgaaaaagagcactttatccgtgcaacttta
gaatcactatgttaccaaactcgtgacgttatggaagcaatgtcaaaagactctggtatt
gatgtccaaagtttacgtgtcgatggtggtgcagttaaaaacaactttattatgcagttc
caagcagacattgttaatacttctgttgaaagacctgaaattcaagaaactacagcttta
ggtgctgcatttttagcaggattagcagttggattctgggagagtaaagatgatatcgct
aaaaactggaaattagaagaaaaattcgatccgaaaatggatgaaggcgaaagagaaaaa
ttatatagaggttggaaaaaagctgttgaagcaacacaagtttttaaaacagaataa

DBGET integrated database retrieval system