KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_1329Help
Entry
MS7_1329          CDS       T01950                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:suz01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:suz00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:suz00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1407987..1409120
Genome map
AA seq 377 aa AA seqDB search
MPAIIELKKAYKEAKADPEFQRELEYYLSEYVGRATPLTYAASYTESLGGAKIYLKREDL
NHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASATVAALFDMELVVFMGSEDIK
RQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTI
VRDFQSVIGKEIKSQILKKEGRLPDAIVACIGGGSNAIGTFYPFIKDDVALYGVEAAGQG
EDTDKHALAIGKGSPGVLHGTKMYLIQDEDGQVQLAHSISAGLDYPGIGPEHSYYHDIGR
VTFENASDTQAMNALINFTKHEGIIPAIESAHALSYVERLAPTMSKEDIIVVTISGRGDK
DMETIRQYMAERGLAND
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaattattgagttgaaaaaagcttataaagaggcaaaagcagacccagagttt
caaagagaactggaatactatttatcagagtatgtaggacgcgcgacgccacttacatat
gctgcatcatatactgaaagcctaggtggcgctaaaatatatttgaaacgagaggatcta
aatcatacaggcgcccataaaattaataatgcgttaggtcaagcgttgcttgctaaaaga
atgggcaagaagaagcttgttgctgaaactggtgcgggccaacatggtgtagctagtgct
acggttgctgcattatttgatatggaacttgttgtctttatgggaagtgaagatattaaa
agacaacaacttaatgtatttagaatggaattacttggtgcaaaggttgtggcagttgaa
gatggtcaagggactttatcggatgcagttaataaagcattgcaatattgggtaagtcat
gtagatgatacacattatttattaggttctgcattaggtccagacccgttcccaacgatt
gttagagattttcagagtgtgattggtaaagaaataaaatcacagatattgaagaaagaa
ggtcgacttccggatgcaattgtagcatgtatcggtggtggctcaaatgcaatcggtaca
ttttatccatttattaaagatgatgttgcattatacggtgttgaagccgcaggtcaaggc
gaggatactgataaacatgcacttgcaattggcaaaggatcacctggcgtattacatggt
actaaaatgtatttaattcaagatgaagatgggcaagtgcaactagcacattctatttca
gcaggacttgattatcctggtattggaccagaacattcttattaccacgacattggtaga
gtaacttttgaaaatgcaagtgatacacaagcaatgaatgctttaatcaactttacaaaa
catgaaggtattatacctgcaattgaaagtgcacatgcactgagttatgttgaaagacta
gcgcctacgatgtcgaaagaagatattattgtagtaactatttctggacgtggcgataaa
gatatggaaacaattagacaatatatggcagagcgaggtcttgcaaatgactaa

DBGET integrated database retrieval system