KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_1657Help
Entry
MS7_1657          CDS       T01950                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:suz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1751933..1752535)
Genome map
AA seq 200 aa AA seqDB search
MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIHTSLIVREDAQLLY
GFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTA
RQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEKTLN
KNKYDSVDEAVKAGLQLVVS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgtatgtcaaaggtaagttaacacatttatatcctacacacgtagttgttgaa
actgctggtgttggttatgaaattcaaacaccaaattcttatcgttttcaaaagcattta
gatcatgaagttttaattcatacatctttaattgttcgtgaagatgcacaattattgtat
ggatttagtagtgaagaagagaaagatatgttcttgagtttaattaaagttactggtatt
ggtccgaaatcagctttagctattttagcgacaagtacgcctaatgaagtaaaacgtgcc
attgaaaatgaaaatgatacgtatttaactaaattcccaggaattggtaagaaaacggca
agacagattgtcttagatttaaaaggtaaagtgaaaattactgaagaagatagcgattca
ttattacaagtagacgctacttcgacggtgcaagatcaattcgtgcaagaagcaatgtta
gcgttagaagcattaggttattctaaacgagagcttgcaaaagttgagaaaacgttaaat
aaaaataaatatgactcagttgatgaagctgttaaggcaggtcttcaattagttgtatct
taa

DBGET integrated database retrieval system