KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_1676Help
Entry
MS7_1676          CDS       T01950                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MS7_1676 (hemB)
Enzymes [BR:suz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MS7_1676 (hemB)
Exosome [BR:suz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MS7_1676 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1768790..1769764)
Genome map
AA seq 324 aa AA seqDB search
MKFDRHRRLRSSATMRDMVRENHVRKEDLIYPIFVVEKDDVKKEIKSLPGVYQISLNLLE
SELKEAYDLGIRAIMFFGVPNSKDDIGTGAYIHDGVIQQATRIAKKMYDDLLIVADTCLC
EYTDHGHCGVIDDHTHDVDNDKSLPLLVKTAISQVEAGADIIAPSNMMDGFVAEIRRGLD
EAGYYNIPIMSYGVKYASSFFGPFRDAADSAPSFGDRKTYQMDPANRLEALRELESDLKE
GCDMMIVKPALSYLDIVRDVKNHTNVPVVAYNVSGEYSMTKAAAQNGWIDEERVVMEQMV
SMKRAGADMIITYFAKDICRYLDK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatagacatagaagattgagatcatcagcgacaatgagagatatggttaga
gagaatcatgtaagaaaagaagatttaatatatccaatttttgtagttgaaaaagacgat
gtgaaaaaagaaattaagtcattgccaggtgtataccaaatcagtttgaatttacttgaa
agtgaattaaaagaagcttatgacttaggcatacgtgccattatgtttttcggtgttcca
aactcaaaagatgatataggtactggtgcatacattcacgatggtgttattcaacaggca
acacgtattgctaaaaaaatgtatgatgacttattaattgttgcagacacttgtttatgt
gaatatactgatcatggtcattgtggcgtgattgatgaccatacacatgacgttgacaat
gataaatcattgccactgcttgttaaaacagcaatttctcaagtggaagctggtgctgat
attattgcgccaagtaatatgatggatggttttgttgctgaaattcgtcgtggattagat
gaagccggctattacaatattcctataatgagttatggtgtcaagtatgcatcaagtttc
tttggaccttttagagatgcagcagattcagcgccatcatttggggatagaaaaacgtat
cagatggaccctgctaaccgtttggaagcacttcgtgaattagaaagtgatcttaaagaa
gggtgcgacatgatgattgttaaacctgctctaagttatttagacatagttcgagatgtt
aaaaatcatacgaatgttccagttgttgcatataatgtgagtggagaatatagtatgact
aaagcagcggcacaaaatggttggatagatgaagaacgtgtcgttatggaacaaatggtt
tcaatgaaacgtgcaggtgctgatatgattattacgtattttgcaaaggacatttgtcgc
tatttagataaataa

DBGET integrated database retrieval system