KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_2038Help
Entry
MS7_2038          CDS       T01950                                 

Gene name
dapE
Definition
putative succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:suz01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:suz00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2117008..2118231
Genome map
AA seq 407 aa AA seqDB search
MTTFSEKEKIQLLADIVELQTENNNEIDVCNYLKDLFDKYDIKSEILKVNEHRANIVAEI
GNGSPILALSGHMEVVDAGNQDNWTYSPFQLTEKDGKLYGRGTTDMKGGLMALVITLIEL
KEQNQLPQGTIRLLATAGEEKEQEGAKLLADKGYLDDVDGLIIAEPTGSGIYYAHKGSMS
CKVTATGKAVHSSVPFIGDNAIDTLLEFYNQFKEKYSELKKHDTKHELDVAPMFKSLIGK
EISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNVRPVPEYDNDFIESFFQNIINN
VDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVDKDDIFVSALVGATDASSFLGDN
KDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEASIQYLKEK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttttagtgaaaaagaaaaaattcaattactagcagatattgttgaactacaa
actgaaaataataatgaaatagacgtttgtaattatttaaaagatttattcgacaagtac
gatattaaatctgagattttgaaagttaatgaacaccgcgccaatatcgttgcagaaatc
ggtaacggctcacctatactcgcattgagtggtcatatggaggttgttgatgcaggaaat
caagataattggacttattccccttttcaactcacagaaaaagatggcaaattatatggt
cgaggcacaacagatatgaaaggcggtctgatggctttggtcatcacactcattgaatta
aaagaacaaaatcaattacctcaaggaacgataagattactagctactgctggcgaagag
aaagaacaagaaggtgccaaattattggctgataaaggctatttagacgatgtagatggc
ttaattattgctgaaccaactggatctggaatttattatgcacataaagggtctatgtca
tgtaaagtaactgcaactggtaaagctgtccatagctcagttccatttattggtgacaat
gcaattgatacactgcttgaattttataatcaatttaaagaaaaatattcagagcttaaa
aaacatgatactaaacatgaattagatgttgcacccatgtttaaatcattgataggaaaa
gaaatttctgaagaggatgcaaattatgcatctggtcttacagctgtatgttcgattata
aatggcggcaaacaatttaactctgtaccagatgaagcttcacttgaatttaacgtaaga
ccagttcctgagtatgataacgactttatagaatcgtttttccaaaatatcattaataat
gtggatagcaataagctttcactcgatattccaagtaatcaccgacctgtaacaagcgat
aaaaatagcaaattaattactacgattaaagatgtagcttctagttatgtagacaaagac
gatatatttgtttcggcgcttgtaggtgcaacagatgcctctagtttcttaggtgataat
aaggacaatgttgatttagccatttttggaccaggtaatccattaatggcacatcaaatc
gatgaatatattgaaaaagatatgtatctgaaatatattgatatttttaaagaagcttcc
attcaatatttaaaagagaaataa

DBGET integrated database retrieval system