KEGG   Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA): MS7_2431Help
Entry
MS7_2431          CDS       T01950                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
suz  Staphylococcus aureus subsp. aureus 11819-97 (CA-MRSA)
Pathway
suz00010  Glycolysis / Gluconeogenesis
suz00260  Glycine, serine and threonine metabolism
suz00680  Methane metabolism
suz01100  Metabolic pathways
suz01110  Biosynthesis of secondary metabolites
suz01120  Microbial metabolism in diverse environments
suz01130  Biosynthesis of antibiotics
suz01200  Carbon metabolism
suz01230  Biosynthesis of amino acids
Module
suz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suz_M00002  Glycolysis, core module involving three-carbon compounds
suz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS7_2431 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MS7_2431 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MS7_2431 (gpmA)
Enzymes [BR:suz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MS7_2431 (gpmA)
Membrane trafficking [BR:suz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MS7_2431 (gpmA)
Exosome [BR:suz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MS7_2431 (gpmA)
  Exosomal proteins of melanoma cells
   MS7_2431 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEW66385
Position
complement(2516909..2517595)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccgcctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattgattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system