KEGG   Streptomyces venezuelae: SVEN_0204Help
Entry
SVEN_0204         CDS       T02274                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase (EC:3.1.2.4)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sve  Streptomyces venezuelae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SVEN_0204
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SVEN_0204
   00650 Butanoate metabolism
    SVEN_0204
  Lipid metabolism
   00071 Fatty acid degradation
    SVEN_0204
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SVEN_0204
   00310 Lysine degradation
    SVEN_0204
   00360 Phenylalanine metabolism
    SVEN_0204
   00380 Tryptophan metabolism
    SVEN_0204
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SVEN_0204
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SVEN_0204
   00281 Geraniol degradation
    SVEN_0204
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SVEN_0204
   00627 Aminobenzoate degradation
    SVEN_0204
   00930 Caprolactam degradation
    SVEN_0204
Enzymes [BR:sve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SVEN_0204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(218201..219295)
Genome map
AA seq 364 aa AA seqDB search
MIVPTGTPDVLLRTEGRAGFITLHRPRAINALTHAMVLAVDAALDAWEHDPAVTTVVIEG
AGDRGLCAGGDIRAIHDDARAGGTASAAFWRDEYRLNARIARYPKPYVALMDGIVMGGGV
GVSAHGSVRVVTERSRLAMPETGIGFVPDVGGTHLLGRAPGELGTHLALTGGRIGAADAI
LTGLADHFVPAAELPALAADLTRLAAEEAVARHTATAPPGVLAEQRPWIDACYAAETVEA
VLERLFDTGEPAAKEAAATLLTKSPTALKATLATLRRSRALSSLEEVLDLEYRTSCAALA
TPDLVEGIRAQVVDKDRDPRWTPPTLPEVTDAAVARYFLVPPGGDLGLAAARRTLQDRAP
RDSA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtgccgaccggaacccccgacgtactcctccggacggagggccgggccggattc
atcaccctccaccgcccccgcgccatcaacgcgctcacccacgccatggtcctcgccgtc
gacgcggccctcgacgcatgggagcacgacccggccgtcaccaccgtcgtcatcgagggc
gccggggaccgcggcctctgcgccggcggcgacatccgcgccatccacgacgacgcccgc
gccggaggaaccgcctccgccgccttctggcgggacgagtaccggctcaacgcccggatc
gcccgctaccccaaaccgtacgtcgccctcatggacggcatcgtcatgggcggcggcgtc
ggcgtctccgcccacggctccgtccgcgtcgtcaccgaacgctcccggctcgccatgccc
gagaccggcatcggcttcgtccccgacgtcggcggcacccacctcctcggccgcgccccc
ggcgaactcggcacccacctcgccctcaccggcggccggatcggcgccgccgacgcgatc
ctcaccggcctcgccgaccacttcgtgcccgccgccgaactccccgccctggcagccgac
ctgacccggcttgcggccgaggaggccgtcgcccgccacacggccaccgccccgcccgga
gtcctcgccgagcagcggccctggatcgacgcctgctacgccgccgagaccgtcgaagcg
gtcctcgagcgcctcttcgacaccggcgagcccgccgccaaggaggcggccgccaccctc
ctcaccaagtccccgaccgccctcaaggcgaccctggccaccctgcgccgctcccgcgcc
ctcagcagcctggaggaggtcctcgacctggagtaccggacctcctgcgccgccctggcc
acccccgacctcgtcgagggcatccgcgcccaggtcgtcgacaaggaccgcgacccccgc
tggaccccgcccacgctccccgaggtcaccgacgcggcggtcgcccgctacttcctcgtc
ccgccgggcggcgacctcggcctcgccgcggcccgtcgcacgctccaggaccgggcgccc
cgggacagcgcgtga

DBGET integrated database retrieval system