KEGG   Streptomyces venezuelae: SVEN_0220Help
Entry
SVEN_0220         CDS       T02274                                 

Definition
(GenBank) Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
sve  Streptomyces venezuelae
Pathway
sve00984  Steroid degradation
sve01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SVEN_0220
Enzymes [BR:sve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SVEN_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N Pyr_redox_2 NAD_binding_8 FAD_binding_3 DAO FAD_binding_2 TAT_signal GIDA
Motif
Other DBs
NCBI-ProteinID: CCA53507
UniProt: F2R5J6
Position
complement(233369..235012)
Genome map
AA seq 547 aa AA seqDB search
MSELPLPARGMGGVSRRRFLAGTGSVLGAAALAGHSTPAHAETRLADTPLPTGSHVPALV
IGTGYGGSVAALRLARAGIAVHMVEMGMAWNTPGPDGKIFANTTRPDYRSFWLRTRTKQP
LSNFLGFPLDKDVPSHTGILDAEDFAGITVYQGRGVGGGSLVNGGMAVTPRRENFAAILP
TVDAAEMYSTYYPRANAGLGVTSVDQTWWESAACYQYARVGRKHAQRSGFPFVFVPNVYD
WDYMKQEAAGAVPKSALDGEVIYGNNAGKKSLQKTYLAQAAATGRVTVSALHKVTSVTPA
AGGGYTVAIDQIDTTGATLASKTVTADKVFFAAGSIGTSKLLTRLKATGALPALNNEIGK
GWGDNGNVMCGRANHMWDPTGKLQSSMPTAGIDNWDAGGAFAEVAPLPTGIETYASFYLS
ITKTPHRAEFTYNPATGKVDLSWDRAWKQTSIDAAKTIFDKINAKEGTIYRTDLFGAYKI
WGDHLTYHPLGGAVLGKATDNHGRLHGYSGLYVIDGSLIPGNASVNPFVTITALAERNIE
RIVAEDF
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactccccctgcctgcaaggggaatgggtggcgtgagtcgccgtcgattcctc
gcaggaacaggttctgttctcggcgccgcggccctcgccggccacagcacccccgcccac
gcggaaacccgcctcgccgacacccccctccccaccggctcccacgtgcccgccctcgtc
atcggcaccgggtacggcggctccgtcgccgcactccgcctcgcccgggcgggcatcgcc
gtccacatggtcgagatgggcatggcctggaacacccccggccccgacggcaagatcttc
gccaacaccacccggcccgactaccgctccttctggctgcggacccgcacgaagcagccc
ctcagcaacttcctcggcttccccctcgacaaggacgtccccagccacaccggcatcctc
gacgcggaggacttcgccggcatcaccgtctaccaggggcgcggcgtcggcggcggctcc
ctcgtcaacggcggcatggccgtcaccccgcgccgcgagaacttcgcggccatcctcccc
accgtcgacgcggcggagatgtactccacgtactacccgcgcgccaacgccggactcggc
gtcacctccgtcgaccagacctggtgggagagcgccgcctgctaccagtacgcccgcgtc
ggccgcaagcacgcccagcgctccggcttcccgttcgtcttcgtcccgaacgtgtacgac
tgggactacatgaagcaggaggccgccggagccgtcccgaagtcggccctcgacggcgag
gtcatctacggcaacaacgccggcaagaagagcctccagaagacctacctggcccaggcc
gccgccaccggcagggtcaccgtctcggccctccacaaggtcacctccgtcaccccggcg
gcgggcggcggctacaccgtcgccatcgaccagatcgacaccaccggcgccaccctcgcc
agcaagacggtgaccgccgacaaggtgttcttcgccgccggaagcatcggcaccagcaaa
ctcctcacccgcctcaaggccaccggcgccctccccgcgctcaacaacgagatcggcaag
ggctggggcgacaacggcaacgtcatgtgcggccgcgccaaccacatgtgggacccgacc
ggcaagctccagtcgtccatgcccaccgcgggcatcgacaactgggacgcgggcggcgcc
ttcgccgaggtcgccccgctgcccaccggcatcgagacctacgcctccttctacctctcc
atcaccaagaccccccaccgggccgagttcacctataacccggcgaccggaaaggtcgac
ctgagctgggacagggcctggaagcagacctccatcgacgcggcgaagaccatcttcgac
aagatcaacgccaaggagggcacgatctaccgcaccgacctgttcggtgcgtacaagatc
tggggcgaccacctcacgtaccacccgctcggcggcgcggtcctcggcaaggcgaccgac
aaccacggacggctccacggctactccgggctgtacgtcatcgacggctcgctgatcccg
ggcaacgccagcgtcaacccgttcgtcaccatcacggccctcgccgaacgcaacatcgaa
cggatcgtcgccgaggacttctga

DBGET integrated database retrieval system