KEGG   Streptomyces venezuelae: SVEN_0675Help
Entry
SVEN_0675         CDS       T02274                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sve  Streptomyces venezuelae
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sve00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:sve00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(789559..790368)
Genome map
AA seq 269 aa AA seqDB search
MSALDLVSAAPRPSAVVLDLTGRTALVTGAAGGIGRACALRLAAAGARVRAVDRAAEGLE
TLTAQAEGLPGSLEPRLLDLTDLDAAEAAAAGADILVNNAGIQLVRPIEEFPPDVFHTVL
TVMLEAPFRLIRGALPHMYAQGWGRIVNLSSVHGLRASAFKSAYVAAKHGLEGLSKTAAL
EGAPHGVTSNCVNPGYVRTPLVERQIADQAAAHGIPPERVLSEVLLKDSALKRLIEPDEV
AEAVLYLCTSQASFITGTSLTLDGGWTAH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccctagatctcgtctccgccgcaccccggcccagcgccgtcgtcctcgacctc
accggccgcaccgcgctcgtcaccggcgcggccggcggcatcgggcgcgcctgcgcgctg
cggctcgccgccgcgggggcccgggtcagagccgtcgaccgggccgccgagggactggag
acgctgacggcacaggccgaggggctccccggcagcctcgaaccccggctcctcgacctc
accgacctggacgccgcggaggctgccgcggccggcgccgacatcctggtcaacaacgcc
gggatccagctcgtccgtcccatcgaggagttcccgccggacgtcttccacaccgtgctc
acggtgatgctggaggcgcccttccgtctgatccggggcgccctgccgcacatgtacgcg
cagggctggggccggatcgtcaacctctcctccgtccacggactgcgcgcctccgcgttc
aagtccgcgtatgtggccgccaaacacggtcttgagggcctctccaagaccgccgccctc
gaaggcgccccgcacggcgtcacctcgaactgcgtcaaccccggctacgtccgcaccccg
ctcgtcgaacgccagatcgccgaccaggccgccgcgcacggcatcccgccggagcgcgtc
ctgtccgaggtgctcctgaaggactcggcgctcaagcggctcatcgaacccgacgaggtc
gccgaggccgtgctctacctctgcacctcccaggcctccttcatcaccggcacctccctc
accctcgacggcggctggacggcccactga

DBGET integrated database retrieval system