KEGG   Streptomyces venezuelae: SVEN_0823Help
Entry
SVEN_0823         CDS       T02274                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sve  Streptomyces venezuelae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SVEN_0823
   01230 Biosynthesis of amino acids
    SVEN_0823
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_0823
   00030 Pentose phosphate pathway
    SVEN_0823
   00051 Fructose and mannose metabolism
    SVEN_0823
   00052 Galactose metabolism
    SVEN_0823
  Energy metabolism
   00680 Methane metabolism
    SVEN_0823
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SVEN_0823
Enzymes [BR:sve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SVEN_0823
Protein phosphatases and associated proteins [BR:sve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SVEN_0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
950364..951389
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVVDHGDEVIGFHDGWKGLLECDYRKLDLEAVGGI
LARGGTILGSSRVQPAHLVGGVERARGHVADLGLDAIIPIGGEGTLKAANLLSEAGLPIV
GVPKTIDNDIASTDVTFGFDTAVTVATEALDRLKTTAESHQRVLVVEVMGRHTGWIALHS
GMAAGAHAVVVPERPFDIDELTTRVGERFEAGKRFAIVVVAEGAKPREGSMDFKTAGTDI
YGHERFTGIANQLSVELERRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAAHR
GEFGMLTALRGTEITMVPLARAVESLKTVPADRYAEAECVI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattggcgtgctcacctccggcggagactgccccggtctgaacgctgtcatccgt
tccgtcgtgcaccgcgccgtcgtcgaccacggcgacgaggtcatcggcttccacgacggc
tggaagggcctcctggagtgcgactaccgcaagctcgatctcgaagcggtgggcggcatc
ctggcccggggcggcaccatcctcggctcctcgcgggtccagcccgcgcacctggtcggc
ggtgtcgagcgcgcccgcggccacgtggccgacctgggcctcgacgcgatcatcccgatc
ggcggcgagggcaccctcaaggcggcgaacctgctctccgaggcgggtctgcccatcgtc
ggcgtccccaagaccatcgacaacgacatcgcctccaccgacgtcaccttcggcttcgac
acggccgtgaccgtcgccaccgaggccctcgaccggctgaagaccaccgccgagtcccac
cagcgcgtcctcgtcgtcgaggtcatgggccgtcacaccggctggatagcgctgcactcc
gggatggccgccggcgcgcacgccgtggtcgtccccgagcgccccttcgacatcgacgag
ctgaccacccgggtcggcgagcgcttcgaggcgggcaagcggttcgcgatcgtcgtggtg
gccgagggcgcgaagccgcgcgagggctcgatggacttcaagaccgccggcaccgacatc
tacggccacgagcggttcaccgggatcgcgaaccagctctcggtcgagctggagcggcgc
ctcggcaaggaggcgcggccggtcatcctcggccacgtccagcgcggcggcacccccacc
gcgtacgaccgcgtcctcgcgacccgcttcggctggcacgcggtggaggcggcgcaccgc
ggcgagttcggcatgctgacggcgctgcgcggcacggagatcacgatggttccgctggcc
cgggccgtggagagcctcaagacggtccccgccgaccgctacgccgaggccgagtgcgtg
atctga

DBGET integrated database retrieval system