KEGG   Streptomyces venezuelae: SVEN_1087Help
Entry
SVEN_1087         CDS       T02274                                 

Definition
Aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sve  Streptomyces venezuelae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sve00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sve00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1232859..1233845)
Genome map
AA seq 328 aa AA seqDB search
MMRHLISAADLTRDDAVQILDTAEEMARVADRPIKKLPTLRGRTICNLFFEDSTRTRISF
EAAEKRLSADVINFAAKGSSVSKGESLKDTAQTLEAMGVDAVVIRHGASGAPFRLATSGW
IDAPVINAGDGTHQHPTQALLDAFTMRRRLVGRDAGLGQDLAGKRITLVGDVLHSRVARS
NVDLLHTLGAEVTLVAPPTLVPVGVETWPCEVSYDLDRVLPKSDAVMMLRVQRERMNAAF
FPTEREYSRRYGLDGERMAKMPEHAIVMHPGPMVRGMEITAEVADSDRCTAVEQVANGVS
VRMAVLYLLLGGNDSDSAVTHTRTEENK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtcacctcatctcggccgccgacctcacccgcgacgacgccgtccagatcctc
gacaccgccgaggagatggcccgggtggccgaccggcccatcaagaagctgccgacgctg
cgcggccggaccatctgcaacctcttcttcgaggactccacccggacccggatctccttc
gaggccgccgagaagcgcctctccgccgacgtgatcaacttcgcggccaagggctccagc
gtctccaagggcgagtccctcaaggacaccgcgcagaccctggaggccatgggcgtcgac
gcggtcgtcatccgccacggcgcctccggggccccgttccgcctggccacctccggctgg
atcgacgcccccgtcatcaacgccggcgacggcacccaccagcaccccacccaggccctc
ctggacgccttcaccatgcgccgccgcctggtcggccgggacgccgggctcggccaggac
ctcgcgggcaagcggatcacgctcgtcggcgacgtgctgcacagccgggtcgcccgctcc
aacgtcgacctgctgcacaccctcggcgccgaggtcaccctggtggcaccgccgaccctg
gtcccggtcggcgtggagacctggccctgcgaggtctcgtacgacctcgaccgcgtgctg
ccgaagtccgacgcggtcatgatgctgcgtgtgcagcgagagcggatgaacgccgccttc
ttccccaccgagcgcgagtactcgcgccggtacgggctggacggcgagcggatggcgaag
atgcccgagcacgccatcgtcatgcaccccggccccatggtccgcggcatggagatcacc
gccgaggtcgccgactccgaccgctgcacggccgtcgagcaggtcgccaacggcgtctcc
gtccggatggcggtcctctacctgctcctgggcggcaacgactccgactccgccgtcacc
cacacccgtaccgaggagaacaagtaa

DBGET integrated database retrieval system