KEGG   Streptomyces venezuelae: SVEN_1253Help
Entry
SVEN_1253         CDS       T02274                                 

Definition
Glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sve  Streptomyces venezuelae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SVEN_1253
Enzymes [BR:sve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SVEN_1253
Exosome [BR:sve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SVEN_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1410324..1411856
Genome map
AA seq 510 aa AA seqDB search
MTDAHTSGPFIAAIDQGTTSSRCIVFDKDGRIVSVDQKEHEQIFPKPGWVEHDAAEIWAN
VQEVVAGALAKGGIAAADVKAIGITNQRETTLLWDKNTGEPVHNALVWQDTRTDALCKEL
GRNVGQDRFRRETGLPLASYFAGPKIRWMLDNVEGLRERAEAGDILFGTMDSWVIWNLTG
GTDGGVHVTDVTNASRTMLMNLHTLAWDEKIAESMGVPLNVLPEIRSSAEVYGHVKNGVL
AGVPVASALGDQQAALFGQTCFAEGEAKSTYGTGTFMLMNTGDKIINSYSGLLTTVGYQI
GDQKPVYALEGSIAVTGSLVQWMRDQMGLIKSAAEIETLASSVEDNGGAYFVPAFSGLFA
PYWRSDARGVIAGLTRYVTKAHIARAVLEATAWQTREITDAMTKDSGVELTALKVDGGMT
SNNLLMQTLSDFLDAPVVRPMVAETTCLGAAYAAGLAVGFWPDTDALRANWRRAAEWTPR
MDAGRRDSEYKSWLKAVERSMGWLDDASEE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgcacacacctccggcccgttcatcgcggccatcgaccagggcaccacctcc
tcccgctgcatcgtcttcgacaaggacggccggatcgtctcggtcgaccagaaggagcac
gagcagatcttcccgaagccgggctgggtcgagcacgacgccgccgagatctgggccaac
gtccaggaggtcgtcgccggcgccctggcgaagggcggcatcgccgccgccgacgtcaag
gccatcggcatcaccaaccagcgcgagaccaccctgctctgggacaagaacaccggtgag
cccgtccacaacgccctcgtctggcaggacacccgcaccgacgccctctgcaaggagctc
ggccgcaacgtcggccaggaccgcttccggcgcgagaccggcctgccgctggcgagctac
ttcgccggcccgaagatccgctggatgctcgacaacgtcgagggcctgcgggagcgcgcc
gaggccggcgacatcctcttcggcaccatggactcgtgggtcatctggaacctcaccggt
ggcaccgacggcggcgtgcacgtcaccgacgtcaccaacgcctcgcgcaccatgctgatg
aacctccacaccctggcctgggacgagaagatcgcggagtcgatgggggtccccctcaac
gtcctccccgagatccggtcctccgccgaggtctacggccacgtcaagaacggcgtcctc
gccggcgtcccggtcgcctcggcgctcggtgaccagcaggccgcgctgttcggccagacc
tgcttcgccgagggcgaggccaagtccacgtacggcaccggcaccttcatgctgatgaac
accggtgacaagatcatcaactcctacagcggcctgctgaccacggtcggctaccagatc
ggcgaccagaagccggtctacgccctggagggctcgatcgccgtcaccggctcgctggtg
cagtggatgcgcgaccagatgggcctcatcaagtccgccgccgagatcgagacgctcgcg
tcctcggtcgaggacaacggcggcgcctacttcgtgccggccttctccggcctgttcgcc
ccgtactggcgctccgacgcccgcggtgtgatcgccggcctcacccgctacgtcaccaag
gcgcacatcgcccgtgccgtcctggaggccaccgcctggcagacccgcgagatcaccgac
gccatgacgaaggactccggcgtcgagctgaccgcgctcaaggtcgacggcggcatgacc
tccaacaacctgctgatgcagaccctctcggacttcctcgacgcgccggtcgtgcgcccg
atggtcgccgagaccacctgcctcggtgccgcctatgccgccggcctggccgtcggcttc
tggccggacaccgacgccctgcgcgccaactggcgccgcgcggcggaatggacccctcgc
atggacgccggcaggcgtgacagcgagtacaagagctggctcaaggccgtggaacggtcc
atgggctggctggatgacgcatccgaggagtaa

DBGET integrated database retrieval system