KEGG   Streptomyces venezuelae: SVEN_1359Help
Entry
SVEN_1359         CDS       T02274                                 

Definition
Alcohol dehydrogenase ; Acetaldehyde dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sve  Streptomyces venezuelae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SVEN_1359
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_1359
   00620 Pyruvate metabolism
    SVEN_1359
   00650 Butanoate metabolism
    SVEN_1359
  Lipid metabolism
   00071 Fatty acid degradation
    SVEN_1359
  Amino acid metabolism
   00350 Tyrosine metabolism
    SVEN_1359
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SVEN_1359
   00626 Naphthalene degradation
    SVEN_1359
Enzymes [BR:sve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SVEN_1359
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SVEN_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1522805..1525519)
Genome map
AA seq 904 aa AA seqDB search
MRSQRDFRPLPAGPFPGLFAGHRVSNGDIGEKGTHEGVPAMETEEKVDGLVREALGALDR
FEELDQEQVDHIVKKASLAALAAHGELARLAVEETGRGLFEDKAVKNLFACEHVTHSMAG
LKTAGVIRRDELNGITEIAEPVGVICAMTPVTNPTSTTVFKALIALKTRNPIVFAFHPSA
QKCSAEAARIVRDAAVAAGAPAGCVQWIEEPSMAATALLMNHEGVSTILATGGNAMVKAA
YSCGKPALGVGAGNVPAYVTRSGKLPRAIHDIVLSKAFDNGMICASEQAVILDEEVYEEG
IAEFERLGAHVVTAAEKTKLEEYVFGTTAYATDCAGARLNADVVGRSAHWIAAQAGFEVP
EDTSILLAECAEVGEGEPLTREKLSPVLAALKADSTEHGLELSARMVEFHGLGHSAAIHT
EDEALAEEFGQRVKAVRVIVNAPSTFGGIGDVYNSFLPSLTLGCGSYGHNSVSNNVTAVN
LINVKRIGRRNTNMQWYKVPPKIYFERGAIRYLGEMEGLKRVTIVTDRTMSALGFVRRIT
DILGGREEPVTLQVIDSVEPNPELATVRAGAAAMREFRPDTVIALGGGSPMDAAKIMWLM
YERPEVEFADTKEKFFDIRKRAYRFPRLGEKAKLVAIPTTSGTGSEVTPFAVISDPEAAQ
KYPLADYALTPDVAIVDPLLPLDLPPTVTADSGFDALTHATEAYVSAYANDFTDGQCLQA
IKLIFQNLETCVTQGAKAPEAREKMHNASTIAGMAFANAFLGLVHAMAHTLGNTFHVAHG
RTNALLLPHVIRHNGTVTHKAVPWPKAEVYRAPERFQEIARMLGLPAATPEEGVESYARA
VEELRERCGIPASFQAEGVDEQAFLAALPQQAMNAYADQCAPANPRMPMIDEMKELMTRA
YYGA
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcacaaagggacttccggcccctccccgcaggcccttttcctggccttttcgca
ggtcatcgggtgtcgaatggagacatcggagaaaaagggacccacgaaggagtgcctgcc
atggagaccgaggagaaggtggacggactggtgcgcgaggccctcggggcacttgaccgg
ttcgaggagctcgaccaggaacaggtcgaccacatcgtcaagaaggcctccctcgccgcg
ctggccgcgcacggcgaactggccaggctcgccgtcgaggagaccggacgcggcctcttc
gaggacaaggccgtcaagaacctcttcgcctgcgaacacgtcacccactcgatggccggc
ctcaagaccgccggagtcatccgccgcgacgaactgaacggcatcaccgagatcgccgaa
cccgtcggcgtcatctgcgcgatgacccccgtcaccaaccccacctcgaccacggtcttc
aaggcgctcatcgccctcaagacccgcaacccgatcgtcttcgccttccacccctccgcg
cagaagtgctccgccgaggccgcccggatcgtccgcgacgccgccgtcgccgccggggcg
cccgccggctgcgtgcagtggatcgaggaaccctccatggcggccaccgccctcctgatg
aaccacgagggcgtctccaccatcctcgccaccggcggaaacgccatggtcaaggccgcc
tactcatgcggcaagcccgccctcggcgtcggcgcgggcaacgtccccgcctatgtcacc
cgcagcggcaagctcccgcgcgccatccacgacatcgtgctctcgaaggccttcgacaac
ggcatgatctgcgcctccgagcaggccgtcatcctcgacgaggaggtgtacgaggagggc
atcgccgagttcgagcggctcggcgcccacgtcgtcaccgccgccgagaagaccaagctg
gaggagtacgtcttcggcaccaccgcctacgccaccgactgcgccggagccaggctcaac
gccgacgtcgtcggcaggtccgcccactggatcgccgcccaggccggcttcgaggtcccc
gaggacacctcgatcctcctcgccgagtgcgccgaggtcggcgagggcgagccgctcacc
cgcgagaagctctcaccggtcctcgccgccctcaaggccgacagcaccgagcacggcctc
gaactctccgcccggatggtcgagttccacggcctcggccacagcgccgccatccacacc
gaggacgaggcgctcgccgaggagttcggccagcgcgtcaaggcggtccgcgtcatcgtc
aacgccccctccaccttcggcggcatcggcgacgtctacaactccttcctcccctcgctc
accctcggctgcggctcctacggacacaactccgtctcgaacaacgtcaccgcggtcaac
ctgatcaacgtcaagcggatcggacggcgcaacaccaacatgcagtggtacaaggtgccg
ccgaagatctacttcgaacggggagccatccgctacctcggcgagatggagggcctgaag
cgggtcaccatcgtcaccgaccgcacgatgagcgccctcggcttcgtccggcggatcacc
gacatcctgggcgggcgcgaggagccggtcaccctccaggtcatcgactccgtcgagccc
aacccggagctcgccaccgtccgggccggcgccgccgccatgcgggagttccggccggac
accgtcatcgccctcggcggcggctccccgatggacgcggcgaagatcatgtggctgatg
tacgagcggcccgaggtcgagttcgcggacaccaaggagaagttcttcgacatccgcaag
cgcgcctaccgcttcccgcggctcggcgagaaggcgaagctcgtcgcgatccccaccacc
tcgggcaccggcagcgaggtcacccccttcgccgtcatctccgacccggaggccgcgcag
aagtacccgctcgccgactacgcgctcacccccgacgtcgccatcgtcgacccgctcctg
ccgctcgacctcccgccgacggtcaccgccgactccggcttcgacgccctgacccacgcc
accgaggcctacgtctccgcctacgcgaacgacttcaccgacgggcagtgcctccaggcg
atcaagctgatcttccagaacctggagacctgcgtgacacagggcgccaaggcgcccgag
gcccgcgagaagatgcacaacgcgtccaccatcgccggcatggccttcgccaacgccttc
ctcggcctggtccacgccatggcccacaccctcggcaacaccttccacgtcgcccacggc
cgcaccaacgcgctgctgctcccgcacgtgatccgccacaacggcaccgtcacccacaag
gccgtgccgtggccgaaggccgaggtctaccgggccccggagcgcttccaggagatcgcg
cggatgctcgggctgccggccgcgacccccgaggagggcgtcgagtcctacgcccgggcg
gtggaggagctgcgcgagcggtgcggcatcccggcctccttccaggcggagggcgtcgac
gagcaggccttcctcgcggccctgccgcagcaggcgatgaacgcctacgccgaccagtgc
gccccggccaacccccggatgccgatgatcgacgagatgaaggaactgatgacccgagcg
tactacggcgcgtag

DBGET integrated database retrieval system