KEGG   Streptomyces venezuelae: SVEN_1496Help
Entry
SVEN_1496         CDS       T02274                                 

Definition
ChlI component of cobalt chelatase involved in B12 biosynthesis or ChlD component of cobalt chelatase involved in B12 biosynthesis
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sve  Streptomyces venezuelae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SVEN_1496
Enzymes [BR:sve01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SVEN_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1670880..1672949
Genome map
AA seq 689 aa AA seqDB search
MNTRYPFTAVVGMDDLRLALLLNAVSPAVGGVLVRGEKGTAKSTAVRALAELLPAVPVVA
GCRFSCDPASPDLGCPDGPHGTEPGVQRPARMVELPVGASEDRLVGSLDIEKALADGVKA
FEPGLLAAAHRGILYVDEVNLLSDHLIDHLLDAAAMGSSYVEREGVSVRHAARFLLVGTM
NPEEGELRPQLLDRFGLTVEVAASREPEQRVEVVRRRLAYEDDPGAFAARWADEETALRE
RIVTARELLPEVTLGDAVLLQIAATCAAFEVDGMRADIVMARTATALAAWAGRTEVTSED
VRQAALLALPHRRRRSPFDAPGLDEDKLDETLEQFKGQEPDEDPEPDGPGDGGPGDGGPG
GGVPPQGDGPAAENAPAAEETSPPSPEPASEPAPASAPQGAGSGERAAVAAGEPFRTKVL
SVPGLGEGAAGRRSRARTEHGRTTGSVRPRGALTKLHLAATVQAAAPHQKARGRTGPGLV
VRRDDLRQATREGREGNLVLFVVDASGSMAARQRMSAVKGAVLSLLLDAYQRRDKVGLIT
FRGRDAEVALPPTSSVDAAAARLEKLPTGGRTPLSAGLLKAHDVLRVERLRDASRRPLLV
VVTDGRATGGGADPVALAGRAARLHAAEGTASVVVDCETGPVRLGLARELARELGGTAVT
LDELRADSIAGLVRDVRDVQAGQTTRRAA
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccgctacccgttcaccgccgtcgtcggcatggacgatctgcggctcgcgctg
ctgctgaacgccgtcagcccggccgtcggcggtgtcctcgtgcgcggcgagaaggggacc
gccaagtccaccgccgtgcgcgcgctcgccgagctgctgcccgccgtgcccgtcgtcgcc
ggctgccgcttcagctgcgacccggcctcgcccgacctcggctgccccgacggcccgcac
gggacggagccgggcgtccagcggcccgcgcggatggtcgagctgcccgtcggcgcctcc
gaggaccggctcgtcggttcgctcgacatcgagaaggcgctcgccgacggcgtgaaggcc
ttcgagccggggctgctcgccgcagcccaccggggcatcctgtacgtcgacgaggtcaac
ctcctgagcgatcacctcatcgaccatctgctcgacgccgccgccatgggctcctcgtac
gtcgaacgcgaaggcgtctccgtgcggcacgccgcccggttcctgctcgtcggcaccatg
aaccccgaggagggcgagctgcggccgcagctgctcgaccggttcgggctgaccgtggag
gtcgcggcctcccgggagcccgagcagcgggtggaggtggtgcggcggcggctcgcgtac
gaggacgacccgggcgcgttcgcggcccgctgggcggacgaggagaccgcgctgcgggaa
cggatcgtcaccgcacgggagttgctgccggaggtgacgctcggcgacgccgtgctgctc
cagatcgccgcgacctgcgccgcgttcgaggtcgacggcatgcgcgccgacatcgtcatg
gccaggaccgcgaccgcgctcgccgcctgggcggggcgtaccgaggtgacctccgaggac
gtgcggcaggccgcgctcctcgcgctcccccaccggcgccgccgctcccccttcgacgcg
cccggtctcgacgaggacaagctcgacgagaccctggagcagttcaaggggcaggagccg
gacgaggaccccgagcccgacggccccggtgacggtggtcccggcgacggcgggcccggt
gggggtgttccgccgcagggtgacggtcccgccgccgagaacgcgcccgctgccgaggag
acctccccgccgtcgcccgagcccgcgtccgagcccgcacccgcgtccgcgcctcagggc
gccggttccggcgagcgcgccgccgtcgccgccggtgagcccttccgcaccaaggtgctg
agcgtgcccggactcggcgagggtgcggccgggcggcgctcccgggcccgcaccgagcac
ggccgtaccaccggctccgtacgcccccggggggcgctgaccaagctgcacctggccgcg
accgtgcaggccgccgccccgcaccagaaggccaggggccggaccgggcccgggctcgtg
gtccgccgggacgacctgcggcaggcgacgcgggaggggcgcgaggggaacctggtgctg
ttcgtcgtggacgcctccggttcgatggcggcccggcagcggatgagcgccgtgaagggc
gccgtcctctccctgctgctcgacgcctaccagcggcgcgacaaggtcggtctgatcacc
ttccggggccgggacgccgaggtggcgctgccgccgacctcgtccgtggacgcggccgcc
gcccgcctggagaagcttccgaccggtggccgcacgcccctgtccgccgggctcctgaag
gcccacgacgtgctgcgggtcgagcggctgcgggacgcctcgcgccgcccgctgctggtc
gtggtcaccgacggccgggcgaccggtggcggcgccgacccggtggcgctggccggccgg
gcggcgcggctgcacgccgccgagggcacggcctccgtggtcgtcgactgcgagacgggt
cccgtgcggctcgggctcgcccgggagctcgcccgtgaactcggcggcaccgccgtcacc
ttggacgagctgcgcgccgactcgatcgccggtctcgtccgcgacgtacgagacgtccag
gcaggacagacaaccaggagggccgcttaa

DBGET integrated database retrieval system