KEGG   Streptomyces venezuelae: SVEN_1684Help
Entry
SVEN_1684         CDS       T02274                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sve  Streptomyces venezuelae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SVEN_1684
Enzymes [BR:sve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SVEN_1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1884069..1885007
Genome map
AA seq 312 aa AA seqDB search
MTSIVVLGSTNMDLVAYVPRAPALGETVTGRSFRTIPGGKGANQAVAAARAGGEVSMIGA
VGTDEFGVRLRATLDHGAVDTDLLRTVEGASGTAHIVVDDEGGNAIVVVPGANGTVTSLD
HGDEALIGTADLLLLQLELPLSVVVEGAATARRLGVRTVLTPAPAQPLPPELLAATDLLV
PNEHEAAALTGLTDPREAALALLRDVPEVVVTLGAAGSLYAARGADPVVVPAPRVRAVDT
TGAGDTFVGALAVALGEGRPAPEALAWAGIAAALSVQREGASTSMPFRTEIEAAFGATGG
DEDRDERETDRV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcatcgtcgtactcggcagcaccaacatggacctcgtggcctacgtcccgagg
gccccggccctcggcgagaccgtcaccggccgctcgttccgcacgatcccgggcggcaag
ggcgccaaccaggccgtggccgccgcccgcgccggcggcgaggtgtcgatgatcggcgcg
gtcggcacggacgagttcggggtacggctccgggccacgctcgaccacggcgcggtggac
accgacctcctgcgcaccgtcgagggcgcctccggcaccgcgcacatcgtcgtcgacgac
gagggcggcaacgcgatcgtcgtcgtccccggcgccaacggcaccgtcacctccctcgac
cacggcgacgaggccctcatcggcaccgccgacctcctgctcctccagctcgaactcccc
ctctccgtcgtcgtggagggcgccgcgaccgcccgccgtctcggtgtccgcaccgtcctc
acccccgcccccgcgcagcccctgccccccgaactcctcgccgccaccgatctgttggtg
ccgaacgagcacgaggcggcggcgctcaccggactgaccgacccccgggaggccgccctg
gcgctgctccgggacgtccccgaggtggtcgtcaccctgggcgcggccggcagcctgtac
gcggcccggggcgccgatccggtcgtggtgcccgcgccccgtgtccgggcggtggacacc
accggggccggtgacaccttcgtcggcgcgctcgcggtcgccctcggtgagggccgtccc
gcgcccgaagctctggcctgggcggggatcgccgccgcgctctccgtccagcgcgagggc
gcgtcgacgtcgatgccgttccgcaccgagatcgaggccgccttcggcgccaccggcggg
gacgaggacagggacgagagggagaccgaccgcgtatga

DBGET integrated database retrieval system