KEGG   Streptomyces venezuelae: SVEN_1689Help
Entry
SVEN_1689         CDS       T02274                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sve  Streptomyces venezuelae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SVEN_1689
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SVEN_1689
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SVEN_1689
Enzymes [BR:sve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SVEN_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1889036..1889869)
Genome map
AA seq 277 aa AA seqDB search
MTTGNIQLLSDTLAKAKAENRAALIAYLPAGFPTVDGGIAAIKAAFDGGADVVEVGLPHS
DPVLDGPVIQTADDIALRGGVKIADVMRTVREAHEATGKPVLVMTYWNPIDRYGIERFTE
ELAAAGGAGCILPDLPVQESAVWRENADKHGLATVFVVAPSSKDERLATITAAGSGFVYA
ASLMGVTGTRESVGEQAADLVRRARAAAAPGRELPVCVGLGVSNATQAKEVAAFADGVIV
GSAFVKRILDADGDENAGLAAVKELAAELAEGVRRVS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccgggaacatccagctgctcagcgacaccctcgccaaggcgaaggcggagaac
cgggccgcgctcatcgcgtacctcccggccggcttcccgaccgtcgacggcggcatcgcg
gcgatcaaggccgccttcgacggcggcgcggacgtggtcgaggtcggcctcccgcacagc
gacccggtcctcgacgggccggtcatccagaccgccgacgacatcgccctgcgcggcggc
gtcaagatcgccgacgtcatgcgcacggtccgcgaggcccacgaggccaccggcaagccg
gtcctcgtcatgacgtactggaaccccatcgaccggtacggcatcgagcgcttcaccgag
gagctcgcggcggccggcggcgcgggctgcatcctgcccgacctgccggtccaggagtcc
gcggtctggcgcgagaacgccgacaagcacggtctcgccaccgtcttcgtcgtcgcgccc
agcagcaaggacgagcgcctcgccaccatcacggcggccggctccggcttcgtctacgcc
gcctccctcatgggcgtcaccggtacccgggagtcggtcggcgagcaggcggccgacctg
gtccgccgcgcccgggccgccgccgcgcccggccgggagctccccgtctgcgtcggcctc
ggcgtctccaacgccacccaggcgaaggaggtcgcggccttcgccgacggcgtcatcgtc
ggctccgcgttcgtgaagcggatcctcgacgccgacggcgacgagaacgcgggactcgcc
gccgtaaaggaactggcggccgaactcgccgagggtgtccggcgcgtttcgtaa

DBGET integrated database retrieval system