KEGG   Streptomyces venezuelae: SVEN_1692Help
Entry
SVEN_1692         CDS       T02274                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sve  Streptomyces venezuelae
Pathway
sve00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01130  Biosynthesis of antibiotics
sve01230  Biosynthesis of amino acids
Module
sve_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SVEN_1692
Enzymes [BR:sve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SVEN_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: CCA54979
UniProt: F2RHZ6
Position
complement(1891614..1892477)
Genome map
AA seq 287 aa AA seqDB search
MAEPGSSSPSPSRKGAPRVSVLDEIIEGVRADLAERQARVTLDELKERAAKAPQAKDGVA
ALRGDGVKVICEVKRSSPSKGALAAIADPAGLAADYEAGGAAVISVLTEQRRFGGSLADL
EAVRAKVDIPVLRKDFIVTAYQLWEARAYGADLALLIVAALEQEALVSLIERAESIGLTP
LVEVHDEEEVERAVDAGARIIGVNARNLKTLKVDRSTFERVAPEIPAHIVKVAESGVRGP
HDLIAYANAGADAVLVGESLVTGRDPKAAVADLVAAGAHPALRHGRS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaacctggttcatcatcaccatcaccgtcccggaagggggcccctcgcgtgagt
gtgctcgacgagatcatcgaaggcgtgcgcgccgacctcgcagagcggcaggcgcgggtc
accctcgacgagctcaaggagcgcgccgccaaggcgccgcaggccaaggacggcgtcgcc
gcactgcgcggcgacggcgtcaaggtgatctgcgaggtcaagcgctccagcccgtccaag
ggcgcactcgccgcgatcgccgacccggccggactcgccgcggactacgaggcgggcggc
gcggccgtcatctccgtcctcaccgagcagcgccgcttcggcggctcgctcgcggacctg
gaggccgtccgcgccaaggtcgacatccccgtcctgcgcaaggacttcatcgtcaccgcg
taccagctctgggaggcccgggcgtacggagccgacctcgcgctcctcatcgtcgccgcc
ctggagcaggaggcgctggtctccctcatcgagcgcgccgagtccatcgggctcaccccg
ctcgtcgaggtgcacgacgaggaggaggtcgagcgggccgtcgacgccggcgcccggatc
atcggcgtcaacgcgcgcaacctcaagaccctcaaggtcgaccgctccaccttcgagcgc
gtcgcccccgagatccccgcgcacatcgtcaaggtcgccgagtccggcgtccggggcccg
cacgacctcatcgcctacgccaacgcgggcgcggacgcggtcctggtcggcgagtccctc
gtcaccggccgcgaccccaaggccgccgtcgccgacctcgtcgccgccggcgcccacccc
gccctccggcacggccggagctga

DBGET integrated database retrieval system